Loading...
Catalog No: ARP58627_P050
Price: $0.00
SKU
ARP58627_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ADGRG1 (ARP58627_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GPR56
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rabbit: 86%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADGRG1 (ARP58627_P050) antibody is Catalog # AAP58627 (Previous Catalog # AAPP35764)
ReferenceKe,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320
Description
Gene SymbolADGRG1
Gene Full Nameadhesion G protein-coupled receptor G1
Alias SymbolsBFPP, BPPR, GPR56, TM7LN4, TM7XN1
NCBI Gene Id9289
Protein Nameadhesion G-protein coupled receptor G1
Description of TargetThis gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.
Uniprot IDQ9Y653
Protein Accession #NP_005673
Nucleotide Accession #NM_005682
Protein Size (# AA)693
Molecular Weight76kDa
Protein InteractionsADRB2; UBC; ARRB2;
  1. What is the species homology for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Rabbit".

  2. How long will it take to receive "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADGRG1 Antibody - N-terminal region (ARP58627_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    This target may also be called "BFPP, BPPR, GPR56, TM7LN4, TM7XN1" in publications.

  5. What is the shipping cost for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "76kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADGRG1 Antibody - N-terminal region (ARP58627_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ADGRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADGRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADGRG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADGRG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADGRG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADGRG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADGRG1 Antibody - N-terminal region (ARP58627_P050)
Your Rating
We found other products you might like!