CCR2 Antibody - middle region (ARP58409_P050)

Data Sheet
 
Product Number ARP58409_P050
Product Page www.avivasysbio.com/ccr2-antibody-middle-region-arp58409-p050.html
Product Name CCR2 Antibody - middle region (ARP58409_P050)
Size 100 ul
Gene Symbol CCR2
Alias Symbols CC-CKR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Protein Size (# AA) 374 amino acids
Molecular Weight 42kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1231
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Chemokine (C-C motif) receptor 2
Peptide Sequence Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Target Reference Hendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271
Description of Target This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-CCR2 (ARP58409_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CCR2 (ARP58409_P050) antibody is Catalog # AAP58409 (Previous Catalog # AAPP34424)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCR2
Complete computational species homology data Anti-CCR2 (ARP58409_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CCR2.
Swissprot Id P41597
Protein Name C-C chemokine receptor type 2
Publications

Liang, X., Li, H. & Li, S. A novel network pharmacology approach to analyse traditional herbal formulae: the Liu-Wei-Di-Huang pill as a case study. Mol. Biosyst. 10, 1014-22 (2014). WB, Human, Pig, Rabbit, Rat 24492828

Protein Accession # NP_000638
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CCR2.
Nucleotide Accession # NM_000647
Replacement Item This antibody may replace item sc-30032 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Human, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human 721_B
WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com