CCR2 Antibody - middle region (ARP58409_P050)

• Product Number: ARP58409_P050
• Name: CCR2 Antibody - middle region (ARP58409_P050)
• Protein Size (# AA): 374 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 1231
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine (C-C motif) receptor 2
• Alias Symbols: CKR2, CCR2A, CCR2B, CD192, CKR2A, CKR2B, CMKBR2, MCP-1-R, CC-CKR-2
• Peptide Sequence: Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271
• Description of Target: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCR2 (ARP58409_P050) antibody is Catalog # AAP58409 (Previous Catalog # AAPP34424)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCR2
• Uniprot ID: P41597
• Protein Name: C-C chemokine receptor type 2
• Publications:

  Liang, X., Li, H. & Li, S. A novel network pharmacology approach to analyse traditional herbal formulae: the Liu-Wei-Di-Huang pill as a case study. Mol. Biosyst. 10, 1014-22 (2014). 24492828

• Protein Accession #: NP_000638
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000647
• Tested Species Reactivity: Human
• Gene Symbol: CCR2
• Predicted Species Reactivity: Human, Rat, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human 721_B
  
  WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 721_B cell lysate