Catalog No: ARP58409_P050 (Formerly GWB-MV235A)
Price: $0.00
SKU
ARP58409_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CCR2 (ARP58409_P050) antibody
Product Info
Publications

Liang, X., Li, H. & Li, S. A novel network pharmacology approach to analyse traditional herbal formulae: the Liu-Wei-Di-Huang pill as a case study. Mol. Biosyst. 10, 1014-22 (2014). 24492828

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CCR2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CCR2 (ARP58409_P050) antibody is Catalog # AAP58409 (Previous Catalog # AAPP34424)
ReferenceHendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271
Gene SymbolCCR2
Gene Full NameChemokine (C-C motif) receptor 2
Alias SymbolsCKR2, CCR2A, CCR2B, CD192, CKR2A, CKR2B, CMKBR2, MCP-1-R, CC-CKR-2
NCBI Gene Id1231
Protein NameC-C chemokine receptor type 2
Description of TargetThis gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Uniprot IDP41597
Protein Accession #NP_000638
Nucleotide Accession #NM_000647
Protein Size (# AA)374
Molecular Weight42kDa
  1. What is the species homology for "CCR2 Antibody - middle region (ARP58409_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Pig, Rabbit".

  2. How long will it take to receive "CCR2 Antibody - middle region (ARP58409_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCR2 Antibody - middle region (ARP58409_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CCR2 Antibody - middle region (ARP58409_P050)"?

    This target may also be called "CKR2, CCR2A, CCR2B, CD192, CKR2A, CKR2B, CMKBR2, MCP-1-R, CC-CKR-2" in publications.

  5. What is the shipping cost for "CCR2 Antibody - middle region (ARP58409_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCR2 Antibody - middle region (ARP58409_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCR2 Antibody - middle region (ARP58409_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCR2 Antibody - middle region (ARP58409_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CCR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CCR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CCR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CCR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CCR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CCR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCR2 Antibody - middle region (ARP58409_P050)
Your Rating
We found other products you might like!