Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CCR2 Antibody - middle region (ARP58409_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58409_P050-FITC Conjugated

ARP58409_P050-HRP Conjugated

ARP58409_P050-Biotin Conjugated

Gene Symbol:
CCR2
Official Gene Full Name:
Chemokine (C-C motif) receptor 2
NCBI Gene Id:
1231
Protein Name:
C-C chemokine receptor type 2
Swissprot Id:
P41597
Protein Accession #:
NP_000638
Nucleotide Accession #:
NM_000647
Alias Symbols:
CC-CKR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Replacement Item:
This antibody may replace item sc-30032 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Protein Size (# AA):
374
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCR2
Predicted Species Reactivity:
Human, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-CCR2 (ARP58409_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CCR2 (ARP58409_P050) antibody is Catalog # AAP58409 (Previous Catalog # AAPP34424)
Datasheets/Manuals:
Printable datasheet for anti-CCR2 (ARP58409_P050) antibody
Target Reference:
Hendrickson,S.L., (2008) J. Acquir. Immune Defic. Syndr. 48 (3), 263-271
Publications:

Liang, X., Li, H. & Li, S. A novel network pharmacology approach to analyse traditional herbal formulae: the Liu-Wei-Di-Huang pill as a case study. Mol. Biosyst. 10, 1014-22 (2014). WB, Human, Pig, Rabbit, Rat 24492828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...