| Product Number |
ARP58330_P050 |
| Product Page |
www.avivasysbio.com/sycp1-antibody-n-terminal-region-arp58330-p050.html |
| Name |
SYCP1 Antibody - N-terminal region (ARP58330_P050) |
| Protein Size (# AA) |
976 amino acids |
| Molecular Weight |
114 kDa |
| NCBI Gene Id |
6847 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Synaptonemal complex protein 1 |
| Alias Symbols |
CT8, SCP1, SCP-1, HOM-TES-14 |
| Peptide Sequence |
Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Neumann,F., (2005) Blood 106 (9), 3105-3113 |
| Description of Target |
SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase. |
| Protein Interactions |
UBC; Uba1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-SYCP1 (ARP58330_P050) antibody |
| Blocking Peptide |
For anti-SYCP1 (ARP58330_P050) antibody is Catalog # AAP58330 (Previous Catalog # AAPP32940) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP1 |
| Uniprot ID |
Q15431 |
| Protein Name |
Synaptonemal complex protein 1 |
| Protein Accession # |
NP_003167 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003176 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SYCP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SYCP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Testis
 | Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-SYCP1 antibody (ARP58330_P050) |
|
