RNF5 Antibody - C-terminal region : FITC (ARP58180_P050-FITC)

Data Sheet
 
Product Number ARP58180_P050-FITC
Product Page www.avivasysbio.com/rnf5-antibody-c-terminal-region-fitc-arp58180-p050-fitc.html
Name RNF5 Antibody - C-terminal region : FITC (ARP58180_P050-FITC)
Protein Size (# AA) 180 amino acids
Molecular Weight 19kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 6048
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols RMA1, RING5
Peptide Sequence Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
Protein Interactions TMEM242; CYB561A3; RNF185; YIPF2; UBE2W; SLC38A7; UBE2D4; INSIG2; SEC22A; UBE2E3; ABHD16A; UBE2E2; UBE2D3; UBE2D1; UBC; SLC1A1; RNF5; UBE2K; CYB561; PTGDR2; ADRB2; PXN; env; TNFAIP3; UBC5; DERL1; UBE2J1; UBE2N; UBE2G2; UBE2D2; CFTR; BCAP31; TMEM173; MAVS;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-RNF5 (ARP58180_P050-FITC) antibody
Blocking Peptide For anti-RNF5 (ARP58180_P050-FITC) antibody is Catalog # AAP58180
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5
Uniprot ID Q99942
Protein Accession # NP_008844
Purification Affinity purified
Gene Symbol RNF5
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com