Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

RNF5 Antibody - C-terminal region : FITC (ARP58180_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58180_P050 Unconjugated

ARP58180_P050-HRP Conjugated

ARP58180_P050-Biotin Conjugated

Gene Symbol:
RNF5
NCBI Gene Id:
6048
Swissprot Id:
Q99942
Protein Accession #:
NP_008844
Alias Symbols:
RNF5, G16, NG2, RMA1,
Replacement Item:
This antibody may replace item sc-135376 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
Protein Size (# AA):
180
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RNF5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RNF5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TMEM242; CYB561A3; RNF185; YIPF2; UBE2W; SLC38A7; UBE2D4; INSIG2; SEC22A; UBE2E3; ABHD16A; UBE2E2; UBE2D3; UBE2D1; UBC; SLC1A1; RNF5; UBE2K; CYB561; PTGDR2; ADRB2; PXN; env; TNFAIP3; UBC5; DERL1; UBE2J1; UBE2N; UBE2G2; UBE2D2; CFTR; BCAP31; TMEM173; MAVS;
Blocking Peptide:
For anti-RNF5 (ARP58180_P050-FITC) antibody is Catalog # AAP58180
Datasheets/Manuals:
Printable datasheet for anti-RNF5 (ARP58180_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...