SHOX2 Antibody - middle region (ARP58069_P050)

Data Sheet
 
Product Number ARP58069_P050
Product Page www.avivasysbio.com/shox2-antibody-middle-region-arp58069-p050.html
Name SHOX2 Antibody - middle region (ARP58069_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 35kDa
NCBI Gene Id 6474
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Short stature homeobox 2
Alias Symbols OG12, SHOT, OG12X
Peptide Sequence Synthetic peptide located within the following region: PGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELER
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hillman,R.T., Genome Biol. 5 (2), R8 (2004)
Description of Target SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.
Protein Interactions CDK4; ELAVL1; TRIM29; KDM5B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SHOX2 (ARP58069_P050) antibody
Blocking Peptide For anti-SHOX2 (ARP58069_P050) antibody is Catalog # AAP58069 (Previous Catalog # AAPP32492)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SHOX2
Uniprot ID O60902
Protein Name Short stature homeobox protein 2
Protein Accession # NP_006875
Purification Affinity Purified
Nucleotide Accession # NM_006884
Tested Species Reactivity Human
Gene Symbol SHOX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100%
Image 1
Human 293T
WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com