PIWIL2 Antibody (ARP57108_P050)

• Product Number: ARP57108_P050
• Name: PIWIL2 Antibody (ARP57108_P050)
• Protein Size (# AA): 973 amino acids
• Molecular Weight: 110kDa
• NCBI Gene Id: 55124
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Piwi-like 2 (Drosophila)
• Alias Symbols: CT80, HILI, mili, PIWIL1L
• Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211
• Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).
• Protein Interactions: HSP90AA1; DICER1; DDX4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PIWIL2 (ARP57108_P050) antibody is Catalog # AAP57108 (Previous Catalog # AAPP35436)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2
• Uniprot ID: Q8TC59
• Protein Name: Piwi-like protein 2
• Protein Accession #: NP_060538
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018068
• Tested Species Reactivity: Human
• Gene Symbol: PIWIL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Image 1: Human Small Intestine
  
  WB Suggested Anti-PIWIL2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Small Intestine