Search Antibody, Protein, and ELISA Kit Solutions

PIWIL2 Antibody (ARP57108_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP57108_P050-FITC Conjugated

ARP57108_P050-HRP Conjugated

ARP57108_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-377258 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 85%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-PIWIL2 (ARP57108_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PIWIL2 (ARP57108_P050) antibody is Catalog # AAP57108 (Previous Catalog # AAPP35436)
Datasheets/Manuals:
Printable datasheet for anti-PIWIL2 (ARP57108_P050) antibody
Target Reference:
Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211
Gene Symbol:
PIWIL2
Official Gene Full Name:
Piwi-like 2 (Drosophila)
Alias Symbols:
FLJ10351, HILI, MGC133049, PIWIL1L, mili, CT80
NCBI Gene Id:
55124
Protein Name:
Piwi-like protein 2
Description of Target:
PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).
Swissprot Id:
Q8TC59
Protein Accession #:
NP_060538
Nucleotide Accession #:
NM_018068
Protein Size (# AA):
973
Molecular Weight:
110kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIWIL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIWIL2.
Protein Interactions:
HSP90AA1; DICER1; DDX4;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...