| Product Number |
ARP56981_P050 |
| Product Page |
www.avivasysbio.com/btg4-antibody-middle-region-arp56981-p050.html |
| Name |
BTG4 Antibody - middle region (ARP56981_P050) |
| Protein Size (# AA) |
223 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
54766 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
B-cell translocation gene 4 |
| Alias Symbols |
PC3B, APRO3, OOMD8 |
| Peptide Sequence |
Synthetic peptide located within the following region: ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle. |
| Protein Interactions |
RNF19B; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BTG4 (ARP56981_P050) antibody |
| Blocking Peptide |
For anti-BTG4 (ARP56981_P050) antibody is Catalog # AAP56981 (Previous Catalog # AAPP39925) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BTG4 |
| Uniprot ID |
Q9NY30 |
| Protein Name |
Protein BTG4 |
| Protein Accession # |
NP_060059 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017589 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BTG4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86% |
| Image 1 | Human Brain
 | WB Suggested Anti-BTG4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain |
|
|
