Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP56981_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56981_P050-FITC Conjugated

ARP56981_P050-HRP Conjugated

ARP56981_P050-Biotin Conjugated

BTG4 Antibody - middle region (ARP56981_P050)

Catalog#: ARP56981_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-134287 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BTG4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Complete computational species homology dataAnti-BTG4 (ARP56981_P050)
Peptide SequenceSynthetic peptide located within the following region: ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-BTG4 (ARP56981_P050) antibody is Catalog # AAP56981 (Previous Catalog # AAPP39925)
Datasheets/ManualsPrintable datasheet for anti-BTG4 (ARP56981_P050) antibody
Gene SymbolBTG4
Official Gene Full NameB-cell translocation gene 4
Alias SymbolsMGC33003, PC3B
NCBI Gene Id54766
Protein NameProtein BTG4
Description of TargetThe protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
Swissprot IdQ9NY30
Protein Accession #NP_060059
Nucleotide Accession #NM_017589
Protein Size (# AA)223
Molecular Weight26kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express BTG4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express BTG4.
Protein InteractionsRNF19B; UBC;
Write Your Own Review
You're reviewing:BTG4 Antibody - middle region (ARP56981_P050)
Your Rating
Aviva Live Chat
Aviva Tissue Tool
Aviva Validation Data
Aviva ChIP Antibodies