Search Antibody, Protein, and ELISA Kit Solutions

BTG4 Antibody - middle region (ARP56981_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56981_P050-FITC Conjugated

ARP56981_P050-HRP Conjugated

ARP56981_P050-Biotin Conjugated

Gene Symbol:
BTG4
Official Gene Full Name:
B-cell translocation gene 4
NCBI Gene Id:
54766
Protein Name:
Protein BTG4
Swissprot Id:
Q9NY30
Protein Accession #:
NP_060059
Nucleotide Accession #:
NM_017589
Alias Symbols:
MGC33003, PC3B
Replacement Item:
This antibody may replace item sc-134287 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
Protein Size (# AA):
223
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BTG4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BTG4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human BTG4
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Complete computational species homology data:
Anti-BTG4 (ARP56981_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RNF19B; UBC;
Blocking Peptide:
For anti-BTG4 (ARP56981_P050) antibody is Catalog # AAP56981 (Previous Catalog # AAPP39925)
Datasheets/Manuals:
Printable datasheet for anti-BTG4 (ARP56981_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...