HADH Antibody - C-terminal region (ARP54765_P050)

Data Sheet
 
Product Number ARP54765_P050
Product Page www.avivasysbio.com/hadh-antibody-c-terminal-region-arp54765-p050.html
Name HADH Antibody - C-terminal region (ARP54765_P050)
Protein Size (# AA) 314 amino acids
Molecular Weight 33kDa
NCBI Gene Id 3033
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hydroxyacyl-CoA dehydrogenase
Alias Symbols HAD, HCDH, HHF4, HADH1, SCHAD, HADHSC, MSCHAD
Peptide Sequence Synthetic peptide located within the following region: YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference van (2006) Diabetes 55 (11), 3193-3196
Description of Target HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions MDM2; STAT1; ADH1A; APP; UBC; MAPK3; UBA5; HADH; SLC2A4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HADH (ARP54765_P050) antibody
Blocking Peptide For anti-HADH (ARP54765_P050) antibody is Catalog # AAP54765 (Previous Catalog # AAPP31560)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HADH
Uniprot ID Q16836
Protein Name Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
Protein Accession # NP_005318
Purification Affinity Purified
Nucleotide Accession # NM_005327
Tested Species Reactivity Human
Gene Symbol HADH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Image 1
Human Fetal Muscle
Host: Rabbit
Target Name: HADH
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
Image 2
Human Liver Tissue
HADH antibody - C-terminal region (ARP54765_P050)
Catalog Number: ARP54765_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in mitochondria of hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 3
Human Heart
WB Suggested Anti-HADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com