| Product Number |
ARP54765_P050 |
| Product Page |
www.avivasysbio.com/hadh-antibody-c-terminal-region-arp54765-p050.html |
| Name |
HADH Antibody - C-terminal region (ARP54765_P050) |
| Protein Size (# AA) |
314 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
3033 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Hydroxyacyl-CoA dehydrogenase |
| Alias Symbols |
HAD, HCDH, HHF4, HADH1, SCHAD, HADHSC, MSCHAD |
| Peptide Sequence |
Synthetic peptide located within the following region: YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
van (2006) Diabetes 55 (11), 3193-3196 |
| Description of Target |
HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
MDM2; STAT1; ADH1A; APP; UBC; MAPK3; UBA5; HADH; SLC2A4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HADH (ARP54765_P050) antibody |
| Blocking Peptide |
For anti-HADH (ARP54765_P050) antibody is Catalog # AAP54765 (Previous Catalog # AAPP31560) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HADH |
| Uniprot ID |
Q16836 |
| Protein Name |
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial |
| Protein Accession # |
NP_005318 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005327 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HADH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93% |
| Image 1 | Human Fetal Muscle
 | Host: Rabbit
Target Name: HADH
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Liver Tissue
 | HADH antibody - C-terminal region (ARP54765_P050)
Catalog Number: ARP54765_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in mitochondria of hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
| Image 3 | Human Heart
 | WB Suggested Anti-HADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
