Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP54765_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54765_P050-FITC Conjugated

ARP54765_P050-HRP Conjugated

ARP54765_P050-Biotin Conjugated

HADH Antibody - C-terminal region (ARP54765_P050)

Catalog#: ARP54765_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-170845 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HADH
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data Anti-HADH (ARP54765_P050)
Peptide Sequence Synthetic peptide located within the following region: YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HADH (ARP54765_P050) antibody is Catalog # AAP54765 (Previous Catalog # AAPP31560)
Datasheets/Manuals Printable datasheet for anti-HADH (ARP54765_P050) antibody
Target Reference van (2006) Diabetes 55 (11), 3193-3196
Gene Symbol HADH
Official Gene Full Name Hydroxyacyl-CoA dehydrogenase
Alias Symbols HAD, HADH1, HADHSC, HHF4, M/SCHAD, MGC8392, SCHAD, HCDH, MSCHAD
NCBI Gene Id 3033
Protein Name Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
Description of Target HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q16836
Protein Accession # NP_005318
Nucleotide Accession # NM_005327
Protein Size (# AA) 314
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HADH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HADH.
Protein Interactions MDM2; STAT1; ADH1A; APP; UBC; MAPK3; UBA5; HADH; SLC2A4;
  1. What is the species homology for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "HADH Antibody - C-terminal region (ARP54765_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HADH Antibody - C-terminal region (ARP54765_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    This target may also be called "HAD, HADH1, HADHSC, HHF4, M/SCHAD, MGC8392, SCHAD, HCDH, MSCHAD" in publications.

  5. What is the shipping cost for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HADH Antibody - C-terminal region (ARP54765_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HADH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HADH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HADH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HADH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HADH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HADH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HADH Antibody - C-terminal region (ARP54765_P050)
Your Rating
We found other products you might like!