Search Antibody, Protein, and ELISA Kit Solutions

HADH Antibody - C-terminal region (ARP54765_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54765_P050-FITC Conjugated

ARP54765_P050-HRP Conjugated

ARP54765_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Hydroxyacyl-CoA dehydrogenase
NCBI Gene Id:
Protein Name:
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-170845 from Santa Cruz Biotechnology.
Description of Target:
HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HADH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HADH.
The immunogen is a synthetic peptide directed towards the C terminal region of human HADH
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-HADH (ARP54765_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HADH (ARP54765_P050) antibody is Catalog # AAP54765 (Previous Catalog # AAPP31560)
Printable datasheet for anti-HADH (ARP54765_P050) antibody
Target Reference:
van (2006) Diabetes 55 (11), 3193-3196

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...