ACADVL Antibody - N-terminal region (ARP54486_P050)

• Product Number: ARP54486_P050
• Name: ACADVL Antibody - N-terminal region (ARP54486_P050)
• Protein Size (# AA): 633 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 37
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Acyl-CoA dehydrogenase, very long chain
• Alias Symbols: ACAD6, LCACD, VLCAD
• Peptide Sequence: Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Soon,P.S., (2008) Ann. Surg. 247 (1), 157-164
• Description of Target: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: EEF2K; GPHN; RPSA; ATF2; CDH1; INTS9; ATP5L; UBC; SOCS3; ICT1; ACADVL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACADVL (ARP54486_P050) antibody is Catalog # AAP54486 (Previous Catalog # AAPP31266)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
• Uniprot ID: P49748
• Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
• Publications:

  Yoon, S.-W., Kang, S., Ryu, S.-E. & Poo, H. Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress. Cell Prolif. 43, 584-93 (2010). 21039997

• Sample Type Confirmation:

  ACADVL is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

• Protein Accession #: NP_001029031
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001033859
• Tested Species Reactivity: Human
• Gene Symbol: ACADVL
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
• Image 1: Recombinant protein
  
  Lanes:
  1: Normal controls Normal enzyme expression
  2: Normal controls Normal enzyme expression
  3: Positive mutants Defective enzyme expression
  4: Positive mutants Defective enzyme expression
  5: Positive mutants Defective enzyme expression
  Primary Antibody Dilution:
  1:2000
  Secondary Antibody:
  
  Secondary Antibody Dilution:
  1:1000
  Gene Name:
  ACADVL
  Submitted by:
  David Lombert, Medical College of Wisconsin
  
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-ACADVL Antibody
  Catalog Number: ARP54486_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in cell bodies of pinealocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 3: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: NOP56
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SERPINA3
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Hela
  
  Host: Rabbit
  Target Name: EGFL8
  Sample Type: Hela
  Antibody Dilution: 1.0ug/mlACADVL is supported by BioGPS gene expression data to be expressed in HeLa
• Image 6: Human HepG2
  
  WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysateACADVL is supported by BioGPS gene expression data to be expressed in HepG2