Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54486_P050-FITC Conjugated

ARP54486_P050-HRP Conjugated

ARP54486_P050-Biotin Conjugated

ACADVL Antibody - N-terminal region (ARP54486_P050)

80% of 100
Catalog#: ARP54486_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271225 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ACADVL (ARP54486_P050)
Peptide Sequence Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACADVL (ARP54486_P050) antibody is Catalog # AAP54486 (Previous Catalog # AAPP31266)
Datasheets/Manuals Printable datasheet for anti-ACADVL (ARP54486_P050) antibody
Sample Type Confirmation

ACADVL is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference Soon,P.S., (2008) Ann. Surg. 247 (1), 157-164

Yoon, S.-W., Kang, S., Ryu, S.-E. & Poo, H. Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress. Cell Prolif. 43, 584-93 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21039997

Gene Symbol ACADVL
Official Gene Full Name Acyl-CoA dehydrogenase, very long chain
Alias Symbols ACAD6, LCACD, VLCAD
NCBI Gene Id 37
Protein Name Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
Description of Target ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Swissprot Id P49748
Protein Accession # NP_001029031
Nucleotide Accession # NM_001033859
Protein Size (# AA) 633
Molecular Weight 64kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACADVL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACADVL.
Protein Interactions EEF2K; GPHN; RPSA; ATF2; CDH1; INTS9; ATP5L; UBC; SOCS3; ICT1; ACADVL;
  1. What is the species homology for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACADVL Antibody - N-terminal region (ARP54486_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    This target may also be called "ACAD6, LCACD, VLCAD" in publications.

  5. What is the shipping cost for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACADVL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACADVL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACADVL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACADVL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACADVL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACADVL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACADVL Antibody - N-terminal region (ARP54486_P050)
Your Rating
We found other products you might like!