Catalog No: ARP54486_P050
Price: $0.00
SKU
ARP54486_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ACADVL (ARP54486_P050) antibody
Product Info
ReferenceSoon,P.S., (2008) Ann. Surg. 247 (1), 157-164
Publications

Yoon, S.-W., Kang, S., Ryu, S.-E. & Poo, H. Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress. Cell Prolif. 43, 584-93 (2010). 21039997

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Concentration0.5 mg/ml
Blocking PeptideFor anti-ACADVL (ARP54486_P050) antibody is Catalog # AAP54486 (Previous Catalog # AAPP31266)
Sample Type Confirmation

ACADVL is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Gene SymbolACADVL
Gene Full NameAcyl-CoA dehydrogenase, very long chain
Alias SymbolsACAD6, LCACD, VLCAD
NCBI Gene Id37
Protein NameVery long-chain specific acyl-CoA dehydrogenase, mitochondrial
Description of TargetACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Uniprot IDP49748
Protein Accession #NP_001029031
Nucleotide Accession #NM_001033859
Protein Size (# AA)633
Molecular Weight64kDa
Protein InteractionsEEF2K; GPHN; RPSA; ATF2; CDH1; INTS9; ATP5L; UBC; SOCS3; ICT1; ACADVL;
  1. What is the species homology for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACADVL Antibody - N-terminal region (ARP54486_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    This target may also be called "ACAD6, LCACD, VLCAD" in publications.

  5. What is the shipping cost for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACADVL Antibody - N-terminal region (ARP54486_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACADVL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACADVL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACADVL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACADVL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACADVL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACADVL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACADVL Antibody - N-terminal region (ARP54486_P050)
Your Rating
We found other products you might like!