Search Antibody, Protein, and ELISA Kit Solutions

ACADVL Antibody - N-terminal region (ARP54486_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54486_P050-FITC Conjugated

ARP54486_P050-HRP Conjugated

ARP54486_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Acyl-CoA dehydrogenase, very long chain
NCBI Gene Id:
Protein Name:
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-271225 from Santa Cruz Biotechnology.
Description of Target:
ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACADVL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACADVL.
The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ACADVL (ARP54486_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ACADVL (ARP54486_P050) antibody is Catalog # AAP54486 (Previous Catalog # AAPP31266)
Printable datasheet for anti-ACADVL (ARP54486_P050) antibody
Sample Type Confirmation:

ACADVL is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference:
Soon,P.S., (2008) Ann. Surg. 247 (1), 157-164

Yoon, S.-W., Kang, S., Ryu, S.-E. & Poo, H. Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress. Cell Prolif. 43, 584-93 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21039997

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: ACADVL antibody-N-terminal region (ARP54486_P050) in Normal and Defective enzyme expression using Western blot
Product Page for ACADVL antibody-N-terminal region (ARP54486_P050)

Researcher: Dr. William Rhead, David Lombert, Medical College of Wisconsin
Application: Western blotting
Species + Tissue/Cell type: Lane 1: Normal controls Normal enzyme expression Lane 2: Normal controls Normal enzyme expression Lane 3: Positive mutants Defective enzyme expression Lane 4: Positive mutants Defective enzyme expression Lane 5: Positive mutants Defective enzyme expression
Primary antibody dilution: 1:2000
Secondary antibody dilution: 1:1000

How do Aviva's reagents play a role in your experimental goals? Detect expression of enzyme in human skin fibroblasts
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4 - Good. Short exposure time, sharp bands, low backgrund
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, works well in established protocol.
How did you store the antibody after re-suspension?  -20 d Centigrade freezer
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human, skin fibroblasts, 25ug
How many different experimental trials were conducted using the antibody sample? Two
How was this sample prepared? From lysates of skin fibroblasts, cetrifuged to isolate mitochondrial enzymes
Primary antibody dilution and incubation time: 1:2000, 2 hours
Secondary antibody used and dilution and incubation time: 1:1000, 1 hour
What controls were used in your experiment (positive/negative)? Two normal controls and three deficient mutant strains
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...