Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP54486_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54486_P050-FITC Conjugated

ARP54486_P050-HRP Conjugated

ARP54486_P050-Biotin Conjugated

ACADVL Antibody - N-terminal region (ARP54486_P050)

Rating:
80% of 100
Catalog#: ARP54486_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271225 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ACADVL (ARP54486_P050)
Peptide Sequence Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACADVL (ARP54486_P050) antibody is Catalog # AAP54486 (Previous Catalog # AAPP31266)
Datasheets/Manuals Printable datasheet for anti-ACADVL (ARP54486_P050) antibody
Sample Type Confirmation

ACADVL is supported by BioGPS gene expression data to be expressed in HeLa, HepG2

Target Reference Soon,P.S., (2008) Ann. Surg. 247 (1), 157-164
Publications

Yoon, S.-W., Kang, S., Ryu, S.-E. & Poo, H. Identification of tyrosine-nitrated proteins in HT22 hippocampal cells during glutamate-induced oxidative stress. Cell Prolif. 43, 584-93 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21039997

Gene Symbol ACADVL
Official Gene Full Name Acyl-CoA dehydrogenase, very long chain
Alias Symbols ACAD6, LCACD, VLCAD
NCBI Gene Id 37
Protein Name Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
Description of Target ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Swissprot Id P49748
Protein Accession # NP_001029031
Nucleotide Accession # NM_001033859
Protein Size (# AA) 633
Molecular Weight 64kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACADVL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACADVL.
Protein Interactions EEF2K; GPHN; RPSA; ATF2; CDH1; INTS9; ATP5L; UBC; SOCS3; ICT1; ACADVL;
Write Your Own Review
You're reviewing:ACADVL Antibody - N-terminal region (ARP54486_P050)
Your Rating