ACE2 Antibody - middle region (ARP53751_P050)

• Product Number: ARP53751_P050
• Name: ACE2 Antibody - middle region (ARP53751_P050)
• Protein Size (# AA): 805 amino acids
• Molecular Weight: 89kDa
• NCBI Gene Id: 59272
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
• Description:
  View product citations for ACE2 Antibody - middle region (ARP53751_P050) on CiteAb
• Alias Symbols: ACEH
• Peptide Sequence: Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Haga,S., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7809-7814
• Description of Target: ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This protein catalyzes the cleavage of angiotensin I into angiotensin 1-9. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: ACE2; AGT; CALM1; NTS; GHRL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
• Blocking Peptide: For anti-ACE2 (ARP53751_P050) antibody is Catalog # AAP53751 (Previous Catalog # AAPP30589)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACE2
• Uniprot ID: Q9BYF1
• Protein Name: Angiotensin-converting enzyme 2
• Publications:

  ACE2 Therapy Using Adeno-associated Viral Vector Inhibits Liver Fibrosis in Mice. Mol. Ther. 23, 1434-43 (2015). 25997428

  Plasma and tissue angiotensin-converting enzyme 2 activity and plasma equilibrium concentrations of angiotensin peptides in dogs with heart disease. J Vet Intern Med. 33, 1571-1584 (2019). 31254308

  Tropism of SARS-CoV-2, SARS-CoV and influenza virus in canine tissue explants. J Infect Dis. (2021). 33395484

• Protein Accession #: NP_068576
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021804
• Tested Species Reactivity: Human, Rat
• Gene Symbol: ACE2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Rat: 93%
• Image 1: Human kidney
  
  WB Suggested Anti-ACE2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human kidney
• Image 2: Human Testis
  
  Testis
• Image 3: Rat Liver
  
  Host: Rat
  Target Name: ACE2
  Sample Tissue: Rat Liver
  Antibody Dilution: 1ug/ml
• Image 4: Rat Liver
  
  Host: Rabbit
  Target Name: ACE2
  Sample Tissue: Rat Liver
  Antibody Dilution: 1ug/ml
• Image 5: Rat liver
  
  Lane 1: 50ug rat liver lysate
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti rabbit-HRP
  Secondary Antibody Dilution:
  1:2000
  Gene Name:
  ACE2
  Submitted by:
  Chandana Herath
• Image 6:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.