Search Antibody, Protein, and ELISA Kit Solutions

ACE2 Antibody - middle region (ARP53751_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53751_P050-FITC Conjugated

ARP53751_P050-HRP Conjugated

ARP53751_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
NCBI Gene Id:
Protein Name:
Angiotensin-converting enzyme 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17719, HPA000288
Description of Target:
ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This protein catalyzes the cleavage of angiotensin I into angiotensin 1-9. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACE2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACE2.
The immunogen is a synthetic peptide directed towards the middle region of human ACE2
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-ACE2 (ARP53751_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ACE2 (ARP53751_P050) antibody is Catalog # AAP53751 (Previous Catalog # AAPP30589)
Printable datasheet for anti-ACE2 (ARP53751_P050) antibody
Target Reference:
Haga,S., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7809-7814

Mak, KY; Chin, R; Cunningham, SC; Habib, MR; Torresi, J; Sharland, AF; Alexander, IE; Angus, PW; Herath, CB; ACE2 Therapy Using Adeno-associated Viral Vector Inhibits Liver Fibrosis in Mice. 23, 1434-43 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25997428

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: ACE2 antibody - middle region (ARP53751_P050) in rat liver lysate using Western Blot
Product Page for ACE2 antibody - middle region (ARP53751_P050)

Researcher: Chandana Herath
Application: Western Blotting
Species + Tissue/Cell type: Lane 1: 50ug rat liver lysate
Primary antibody dilution: 1:500
Secondary antibody: Goat anti rabbit-HRP
Secondary antibody dilution: 1:2000

How do Aviva's reagents play a role in your experimental goals? Examine protein expression levels via Western Blotting
How would you rate this antibody on a scale from 1-5 (5=best) nad why? 4
Would you use this antibody in future experiment? Yes
Have you used another antibody which has worked in your application? Yes. Didn't work as well
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. It's relatively clear
How did you store the antibody after re-suspension?  -20C.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):  1) Rats 2) Liver 3) 50ug
How many different experimental trials were conducted using the antibody sample? 3
How was this sample prepared?  -Homogenized in  NP10 lysis buffer
-Centrifugation at 45K rpm for 1hr
-Resuspend pellet in NP-10 buffer
-Quantilate using BCA assay
Primary antibody dilution and incubation time:  1/500 Overnight @4 d C
Secondary antibody used and dilution and incubation time: Dako Goat X-Rabbit 1/2000 1hr Room temperature
Please include your detailed WB Procedure/Protocol here: 1) Load 50ug of protein on denaturing gel and run at 100V
2) Transfer protein to PVDF membrane for 1hr at 100V
3) Block membrane in 5% milk in TBS-T for 1hr
4) Probe with 1degree (Primary) Ab ovrnight @ 4 d C (made up in block buffer)
5) Wash 3X for 15 minutes each.
6) Probe with 2degree (Secondary) Ab 1hr at room temperature (made up in block buffer)
7) Wash 3X for 15 minutes each.
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...