Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP53751_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53751_P050-FITC Conjugated

ARP53751_P050-HRP Conjugated

ARP53751_P050-Biotin Conjugated

ACE2 Antibody - middle region (ARP53751_P050)

Rating:
80% of 100
Catalog#: ARP53751_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17719, HPA000288
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACE2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-ACE2 (ARP53751_P050)
Peptide Sequence Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ACE2 (ARP53751_P050) antibody is Catalog # AAP53751 (Previous Catalog # AAPP30589)
Datasheets/Manuals Printable datasheet for anti-ACE2 (ARP53751_P050) antibody
Target Reference Haga,S., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7809-7814
Publications

Mak, KY; Chin, R; Cunningham, SC; Habib, MR; Torresi, J; Sharland, AF; Alexander, IE; Angus, PW; Herath, CB; ACE2 Therapy Using Adeno-associated Viral Vector Inhibits Liver Fibrosis in Mice. 23, 1434-43 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25997428

Gene Symbol ACE2
Official Gene Full Name Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Alias Symbols ACEH, DKFZP434A014
NCBI Gene Id 59272
Protein Name Angiotensin-converting enzyme 2
Description of Target ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This protein catalyzes the cleavage of angiotensin I into angiotensin 1-9. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9BYF1
Protein Accession # NP_068576
Nucleotide Accession # NM_021804
Protein Size (# AA) 805
Molecular Weight 89kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ACE2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ACE2.
Protein Interactions ACE2; AGT; CALM1; NTS; GHRL;
  1. What is the species homology for "ACE2 Antibody - middle region (ARP53751_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ACE2 Antibody - middle region (ARP53751_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ACE2 Antibody - middle region (ARP53751_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ACE2 Antibody - middle region (ARP53751_P050)"?

    This target may also be called "ACEH, DKFZP434A014" in publications.

  5. What is the shipping cost for "ACE2 Antibody - middle region (ARP53751_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ACE2 Antibody - middle region (ARP53751_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ACE2 Antibody - middle region (ARP53751_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ACE2 Antibody - middle region (ARP53751_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ACE2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACE2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACE2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACE2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACE2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACE2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ACE2 Antibody - middle region (ARP53751_P050)
Your Rating
We found other products you might like!