GSTM3 Antibody - middle region (ARP53561_P050)

• Product Number: ARP53561_P050
• Name: GSTM3 Antibody - middle region (ARP53561_P050)
• Protein Size (# AA): 225 amino acids
• Molecular Weight: 27 kDa
• NCBI Gene Id: 2947
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutathione S-transferase mu 3 (brain)
• Description:
  View product citations for GSTM3 Antibody - middle region (ARP53561_P050) on CiteAb
• Alias Symbols: GST5, GSTB, GTM3, GSTM3-3
• Peptide Sequence: Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
• Description of Target: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: GSTM5; GSTM4; GSTM3; GSTM1; UBC; ESR1; BAG3; SUMO2; SH3GL2; UCHL5; GSTM2; MPG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-GSTM3 (ARP53561_P050) antibody is Catalog # AAP53561 (Previous Catalog # AAPS32801)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSTM3
• Uniprot ID: P21266
• Protein Name: Glutathione S-transferase Mu 3
• Publications:

  Glutathione S-Transferases Play a Crucial Role in Mitochondrial Function, Plasma Membrane Stability and Oxidative Regulation of Mammalian Sperm. Antioxidants (Basel). 9, (2020). 31991648

  GSTM3, but not IZUMO1, is a cryotolerance marker of boar sperm. J Anim Sci Biotechnol. 10, 61 (2019). 31391940

• Protein Accession #: NP_000840
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000849
• Tested Species Reactivity: Human
• Gene Symbol: GSTM3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 86%; Rat: 79%
• Image 1: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: GSTM3
  Sample Tissue: Human MCF7 Whole Cell
  Antibody Dilution: 0.2ug/ml
• Image 2: Human Stomach Tumor
  
  Host: Rabbit
  Target Name: GSTM3
  Sample Tissue: Human Stomach Tumor
  Antibody Dilution: 1.0ug/ml