Search Antibody, Protein, and ELISA Kit Solutions

GSTM3 Antibody - middle region (ARP53561_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53561_P050-FITC Conjugated

ARP53561_P050-HRP Conjugated

ARP53561_P050-Biotin Conjugated

Gene Symbol:
GSTM3
Official Gene Full Name:
Glutathione S-transferase mu 3 (brain)
NCBI Gene Id:
2947
Protein Name:
Glutathione S-transferase Mu 3
Swissprot Id:
P21266
Protein Accession #:
NP_000840
Nucleotide Accession #:
NM_000849
Alias Symbols:
GST5, GSTB, GSTM3-3, GTM3, MGC3310, MGC3704
Replacement Item:
This antibody may replace item sc-133642 from Santa Cruz Biotechnology.
Description of Target:
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
225
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GSTM3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GSTM3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GSTM3
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 86%; Rat: 79%
Complete computational species homology data:
Anti-GSTM3 (ARP53561_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GSTM5; GSTM4; GSTM3; GSTM1; UBC; ESR1; BAG3; SUMO2; SH3GL2; UCHL5; GSTM2; MPG;
Blocking Peptide:
For anti-GSTM3 (ARP53561_P050) antibody is Catalog # AAP53561 (Previous Catalog # AAPS32801)
Datasheets/Manuals:
Printable datasheet for anti-GSTM3 (ARP53561_P050) antibody
Target Reference:
Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

196/07/2019 14:17
  • Overall Experience:
  • Quality:
Specific antibody for human and boar samples

Specifically detects GSTM3 in human and boar sperm samples. Peptide competition assay demonstrated specificity of every band.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...