CHCHD1 Antibody - middle region (ARP53491_P050)

• Product Number: ARP53491_P050
• Name: CHCHD1 Antibody - middle region (ARP53491_P050)
• Protein Size (# AA): 118 amino acids
• Molecular Weight: 13kDa
• NCBI Gene Id: 118487
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Coiled-coil-helix-coiled-coil-helix domain containing 1
• Alias Symbols: C2360, MRP-S37, C10orf34
• Peptide Sequence: Synthetic peptide located within the following region: KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Protein Interactions: NEDD1; rev; UBC; ICT1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CHCHD1 (ARP53491_P050) antibody is Catalog # AAP53491 (Previous Catalog # AAPP32033)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHCHD1
• Uniprot ID: Q96BP2
• Protein Name: Coiled-coil-helix-coiled-coil-helix domain-containing protein 1
• Publications:

  Koc, E. C. et al. Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome. Front. Physiol. 4, 183 (2013). 23908630

• Protein Accession #: NP_976043
• Purification: Affinity Purified
• Nucleotide Accession #: NM_203298
• Tested Species Reactivity: Human
• Gene Symbol: CHCHD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 90%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 83%; Rat: 93%
• Image 1: Human U937
  
  WB Suggested Anti-CHCHD1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: U937 cell lysate