Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP53491_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53491_P050-FITC Conjugated

ARP53491_P050-HRP Conjugated

ARP53491_P050-Biotin Conjugated

CHCHD1 Antibody - middle region (ARP53491_P050)

Catalog#: ARP53491_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-142313 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHCHD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 90%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 83%; Rat: 93%
Complete computational species homology dataAnti-CHCHD1 (ARP53491_P050)
Peptide SequenceSynthetic peptide located within the following region: KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CHCHD1 (ARP53491_P050) antibody is Catalog # AAP53491 (Previous Catalog # AAPP32033)
Datasheets/ManualsPrintable datasheet for anti-CHCHD1 (ARP53491_P050) antibody
Publications

Koc, E. C. et al. Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome. Front. Physiol. 4, 183 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat 23908630

Gene SymbolCHCHD1
Official Gene Full NameCoiled-coil-helix-coiled-coil-helix domain containing 1
Alias SymbolsC10orf34, C2360, FLJ25854
NCBI Gene Id118487
Protein NameCoiled-coil-helix-coiled-coil-helix domain-containing protein 1
Description of TargetThe function of this protein remains unknown.
Swissprot IdQ96BP2
Protein Accession #NP_976043
Nucleotide Accession #NM_203298
Protein Size (# AA)118
Molecular Weight13kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CHCHD1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CHCHD1.
Protein InteractionsNEDD1; rev; UBC; ICT1;
Write Your Own Review
You're reviewing:CHCHD1 Antibody - middle region (ARP53491_P050)
Your Rating
Aviva Tissue Tool
Aviva Validation Data
Assay Development
Aviva HIS tag Deal