Search Antibody, Protein, and ELISA Kit Solutions

CHCHD1 Antibody - middle region (ARP53491_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP53491_P050-FITC Conjugated

ARP53491_P050-HRP Conjugated

ARP53491_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-142313 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CHCHD1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 90%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 83%; Rat: 93%
Complete computational species homology data:
Anti-CHCHD1 (ARP53491_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CHCHD1 (ARP53491_P050) antibody is Catalog # AAP53491 (Previous Catalog # AAPP32033)
Datasheets/Manuals:
Printable datasheet for anti-CHCHD1 (ARP53491_P050) antibody
Publications:

Koc, E. C. et al. Identification and characterization of CHCHD1, AURKAIP1, and CRIF1 as new members of the mammalian mitochondrial ribosome. Front. Physiol. 4, 183 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat 23908630

Gene Symbol:
CHCHD1
Official Gene Full Name:
Coiled-coil-helix-coiled-coil-helix domain containing 1
Alias Symbols:
C10orf34, C2360, FLJ25854
NCBI Gene Id:
118487
Protein Name:
Coiled-coil-helix-coiled-coil-helix domain-containing protein 1
Description of Target:
The function of this protein remains unknown.
Swissprot Id:
Q96BP2
Protein Accession #:
NP_976043
Nucleotide Accession #:
NM_203298
Protein Size (# AA):
118
Molecular Weight:
13kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CHCHD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CHCHD1.
Protein Interactions:
NEDD1; rev; UBC; ICT1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...