| Product Number |
ARP52377_P050 |
| Product Page |
www.avivasysbio.com/add2-antibody-c-terminal-region-arp52377-p050.html |
| Name |
ADD2 Antibody - C-terminal region (ARP52377_P050) |
| Protein Size (# AA) |
726 amino acids |
| Molecular Weight |
79 kDa |
| NCBI Gene Id |
119 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
adducin 2 (beta) |
| Alias Symbols |
ADDB |
| Peptide Sequence |
Synthetic peptide located within the following region: SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
N/A |
| Description of Target |
Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADD2 (ARP52377_P050) antibody |
| Blocking Peptide |
For Anti-ADD2 antibody is Catalog # AAP52377 |
| Immunogen |
The immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB |
| Uniprot ID |
P35612 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADD2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human U937 Whole Cell
 | WB Suggested Anti-ADDB antibody Titration: 1 ug/mL
Sample Type: Human U937 Whole Cell |
|
|
