Search Antibody, Protein, and ELISA Kit Solutions

ADD2 Antibody - C-terminal region (ARP52377_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52377_P050-FITC Conjugated

ARP52377_P050-HRP Conjugated

ARP52377_P050-Biotin Conjugated

Gene Symbol:
ADD2
Official Gene Full Name:
adducin 2 (beta)
NCBI Gene Id:
119
Swissprot Id:
P35612
Alias Symbols:
ADDB,
Replacement Item:
This antibody may replace item sc-112593 from Santa Cruz Biotechnology.
Description of Target:
Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described.
Protein Size (# AA):
726
Molecular Weight:
79 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADD2.
Immunogen:
The immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Blocking Peptide:
For Anti-ADD2 antibody is Catalog # AAP52377
Datasheets/Manuals:
Printable datasheet for anti-ADD2 (ARP52377_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...