Product Number |
ARP52054_P050 |
Product Page |
www.avivasysbio.com/endog-antibody-middle-region-arp52054-p050.html |
Name |
ENDOG Antibody - middle region (ARP52054_P050) |
Protein Size (# AA) |
297 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
2021 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Endonuclease G |
Alias Symbols |
FLJ27463 |
Peptide Sequence |
Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Varecha,M., (2007) Apoptosis 12 (7), 1155-1171 |
Description of Target |
ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA. |
Protein Interactions |
UBC; BIRC2; DNAJA4; STUB1; HSPA4; AIFM1; FEN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ENDOG (ARP52054_P050) antibody |
Blocking Peptide |
For anti-ENDOG (ARP52054_P050) antibody is Catalog # AAP52054 (Previous Catalog # AAPP30279) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ENDOG |
Uniprot ID |
Q14249 |
Protein Name |
Endonuclease G, mitochondrial |
Publications |
Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, a9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). 24668500 |
Protein Accession # |
NP_004426 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004435 |
Tested Species Reactivity |
Human |
Gene Symbol |
ENDOG |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Intestine
| WB Suggested Anti-ENDOG Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Intestine |
|