Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP52054_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52054_P050-FITC Conjugated

ARP52054_P050-HRP Conjugated

ARP52054_P050-Biotin Conjugated

ENDOG Antibody - middle region (ARP52054_P050)

Catalog#: ARP52054_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-26923 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENDOG
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-ENDOG (ARP52054_P050)
Peptide Sequence Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ENDOG (ARP52054_P050) antibody is Catalog # AAP52054 (Previous Catalog # AAPP30279)
Datasheets/Manuals Printable datasheet for anti-ENDOG (ARP52054_P050) antibody
Target Reference Varecha,M., (2007) Apoptosis 12 (7), 1155-1171
Publications

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 24668500

Gene Symbol ENDOG
Official Gene Full Name Endonuclease G
Alias Symbols FLJ27463
NCBI Gene Id 2021
Protein Name Endonuclease G, mitochondrial
Description of Target ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
Swissprot Id Q14249
Protein Accession # NP_004426
Nucleotide Accession # NM_004435
Protein Size (# AA) 297
Molecular Weight 28kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ENDOG.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ENDOG.
Protein Interactions UBC; BIRC2; DNAJA4; STUB1; HSPA4; AIFM1; FEN1;
  1. What is the species homology for "ENDOG Antibody - middle region (ARP52054_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "ENDOG Antibody - middle region (ARP52054_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ENDOG Antibody - middle region (ARP52054_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ENDOG Antibody - middle region (ARP52054_P050)"?

    This target may also be called "FLJ27463" in publications.

  5. What is the shipping cost for "ENDOG Antibody - middle region (ARP52054_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ENDOG Antibody - middle region (ARP52054_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ENDOG Antibody - middle region (ARP52054_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ENDOG Antibody - middle region (ARP52054_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ENDOG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENDOG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENDOG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENDOG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENDOG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENDOG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ENDOG Antibody - middle region (ARP52054_P050)
Your Rating
We found other products you might like!