Search Antibody, Protein, and ELISA Kit Solutions

ENDOG Antibody - middle region (ARP52054_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52054_P050-FITC Conjugated

ARP52054_P050-HRP Conjugated

ARP52054_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ENDOG
Official Gene Full Name:
Endonuclease G
NCBI Gene Id:
2021
Protein Name:
Endonuclease G, mitochondrial
Swissprot Id:
Q14249
Protein Accession #:
NP_004426
Nucleotide Accession #:
NM_004435
Alias Symbols:
FLJ27463
Replacement Item:
This antibody may replace item sc-26923 from Santa Cruz Biotechnology.
Description of Target:
ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
Protein Size (# AA):
297
Molecular Weight:
28kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ENDOG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ENDOG.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ENDOG
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ENDOG (ARP52054_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; BIRC2; DNAJA4; STUB1; HSPA4; AIFM1; FEN1;
Blocking Peptide:
For anti-ENDOG (ARP52054_P050) antibody is Catalog # AAP52054 (Previous Catalog # AAPP30279)
Datasheets/Manuals:
Printable datasheet for anti-ENDOG (ARP52054_P050) antibody
Target Reference:
Varecha,M., (2007) Apoptosis 12 (7), 1155-1171
Publications:

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish 24668500

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...