DPH1 Antibody - middle region (ARP51956_P050)

• Product Number: ARP51956_P050
• Name: DPH1 Antibody - middle region (ARP51956_P050)
• Protein Size (# AA): 443 amino acids
• Molecular Weight: 49 kDa
• NCBI Gene Id: 1801
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: DPH1 homolog (S. cerevisiae)
• Alias Symbols: DPH2L, OVCA1, DEDSSH, DPH2L1
• Peptide Sequence: Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Liu,S., (2004) Mol. Cell. Biol. 24 (21), 9487-9497
• Description of Target: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200
• Protein Interactions: UBC; TFCP2; MMS19; UBD; TP63; TP73; TP53; RBM8A; HSPA5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-DPH1 (ARP51956_P050) antibody is Catalog # AAP51956 (Previous Catalog # AAPP40277)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPH1
• Uniprot ID: Q9BZG8
• Protein Name: Diphthamide biosynthesis protein 1
• Sample Type Confirmation:

  DPH1 is supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_001374
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001383
• Tested Species Reactivity: Human
• Gene Symbol: DPH1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
• Image 1: Human MCF-7
  
  WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: MCF7 cell lysateDPH1 is supported by BioGPS gene expression data to be expressed in MCF7
• Image 2: Human Adult Liver
  
  Rabbit Anti-DPH1 Antibody
  Catalog Number: ARP51956_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm (perinuclear) but not nuclear in hepatocytes, strong signal, low tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.