Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP51956_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51956_P050-FITC Conjugated

ARP51956_P050-HRP Conjugated

ARP51956_P050-Biotin Conjugated

DPH1 Antibody - middle region (ARP51956_P050)

Catalog#: ARP51956_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101248 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DPH1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
Complete computational species homology data Anti-DPH1 (ARP51956_P050)
Peptide Sequence Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DPH1 (ARP51956_P050) antibody is Catalog # AAP51956 (Previous Catalog # AAPP40277)
Datasheets/Manuals Printable datasheet for anti-DPH1 (ARP51956_P050) antibody
Sample Type Confirmation

DPH1 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference Liu,S., (2004) Mol. Cell. Biol. 24 (21), 9487-9497
Gene Symbol DPH1
Official Gene Full Name DPH1 homolog (S. cerevisiae)
Alias Symbols DPH2L, DPH2L1, FLJ33211, OVCA1
NCBI Gene Id 1801
Protein Name Diphthamide biosynthesis protein 1
Description of Target Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200
Swissprot Id Q9BZG8
Protein Accession # NP_001374
Nucleotide Accession # NM_001383
Protein Size (# AA) 443
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DPH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DPH1.
Protein Interactions UBC; TFCP2; MMS19; UBD; TP63; TP73; TP53; RBM8A; HSPA5;
  1. What is the species homology for "DPH1 Antibody - middle region (ARP51956_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "DPH1 Antibody - middle region (ARP51956_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DPH1 Antibody - middle region (ARP51956_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DPH1 Antibody - middle region (ARP51956_P050)"?

    This target may also be called "DPH2L, DPH2L1, FLJ33211, OVCA1" in publications.

  5. What is the shipping cost for "DPH1 Antibody - middle region (ARP51956_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DPH1 Antibody - middle region (ARP51956_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DPH1 Antibody - middle region (ARP51956_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DPH1 Antibody - middle region (ARP51956_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DPH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DPH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DPH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DPH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DPH1 Antibody - middle region (ARP51956_P050)
Your Rating
We found other products you might like!