Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DPH1 antibody - middle region (ARP51956_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP51956_P050-FITC Conjugated

ARP51956_P050-HRP Conjugated

ARP51956_P050-Biotin Conjugated

Gene Symbol:
DPH1
NCBI Gene Id:
1801
Official Gene Full Name:
DPH1 homolog (S. cerevisiae)
Protein Name:
Diphthamide biosynthesis protein 1
Swissprot Id:
Q9BZG8
Protein Accession #:
NP_001374
Nucleotide Accession #:
NM_001383
Alias Symbols:
DPH2L, DPH2L1, FLJ33211, OVCA1
Replacement Item:
This antibody may replace item sc-101248 from Santa Cruz Biotechnology.
Description of Target:
Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200
Protein Size (# AA):
443
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DPH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DPH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DPH1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 93%
Complete computational species homology data:
Anti-DPH1 (ARP51956_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TFCP2; MMS19; UBD; TP63; TP73; TP53; RBM8A; HSPA5;
Blocking Peptide:
For anti-DPH1 (ARP51956_P050) antibody is Catalog # AAP51956 (Previous Catalog # AAPP40277)
Datasheets/Manuals:
Printable datasheet for anti-DPH1 (ARP51956_P050) antibody
Sample Type Confirmation:

DPH1 is supported by BioGPS gene expression data to be expressed in MCF7

Target Reference:
Liu,S., (2004) Mol. Cell. Biol. 24 (21), 9487-9497

Tell us what you think about this item!

Write A Review
    Please, wait...