CHI3L1 Antibody - middle region (ARP51929_P050)

• Product Number: ARP51929_P050
• Name: CHI3L1 Antibody - middle region (ARP51929_P050)
• Protein Size (# AA): 383 amino acids
• Molecular Weight: 43 kDa
• NCBI Gene Id: 1116
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chitinase 3-like 1 (cartilage glycoprotein-39)
• Alias Symbols: GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39
• Peptide Sequence: Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ober,C., (2008) N. Engl. J. Med. 358 (16), 1682-1691
• Description of Target: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
• Protein Interactions: CHI3L1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CHI3L1 (ARP51929_P050) antibody is Catalog # AAP51929 (Previous Catalog # AAPP30195)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
• Uniprot ID: P36222
• Protein Name: Chitinase-3-like protein 1
• Publications:

  Kao, T.-H., Peng, Y.-J., Tsou, H.-K., Salter, D. M. & Lee, H.-S. Nerve growth factor promotes expression of novel genes in intervertebral disc cells that regulate tissue degradation. J. Neurosurg. Spine 1-9 (2014). doi:10.3171/2014.6.SPINE13756 25062286

• Protein Accession #: NP_001267
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001276
• Tested Species Reactivity: Human, Monkey
• Gene Symbol: CHI3L1
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Goat, Pig, Rabbit
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 77%; Goat: 92%; Human: 100%; Pig: 92%; Rabbit: 100%; Rat: 77%
• Image 1: Simian IVE
  
  simian immunodeficiency virus encephalitis
• Image 2:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.