Size:100 ul
$319.00
In Stock
SKU
ARP51929_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51929_P050-FITC Conjugated

ARP51929_P050-HRP Conjugated

ARP51929_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityCow, Dog, Goat, Human, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-110933 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHI3L1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 77%; Goat: 92%; Human: 100%; Pig: 92%; Rabbit: 100%; Rat: 77%
Complete computational species homology dataAnti-CHI3L1 (ARP51929_P050)
Peptide SequenceSynthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CHI3L1 (ARP51929_P050) antibody is Catalog # AAP51929 (Previous Catalog # AAPP30195)
Datasheets/ManualsPrintable datasheet for anti-CHI3L1 (ARP51929_P050) antibody
Target ReferenceOber,C., (2008) N. Engl. J. Med. 358 (16), 1682-1691
Publications

Kao, T.-H., Peng, Y.-J., Tsou, H.-K., Salter, D. M. & Lee, H.-S. Nerve growth factor promotes expression of novel genes in intervertebral disc cells that regulate tissue degradation. J. Neurosurg. Spine. 21, 653-61 (2014). IF, WB, Cow, Dog, Goat, Human, Pig, Rabbit, Rat 25062286

Gene SymbolCHI3L1
Official Gene Full NameChitinase 3-like 1 (cartilage glycoprotein-39)
Alias SymbolsDKFZp686N19119, FLJ38139, GP39, HC-gp39, HCGP-3P, YKL40, YYL-40, ASRT7, GP-39, CGP-39, YKL-40, hCGP-39
NCBI Gene Id1116
Protein NameChitinase-3-like protein 1
Description of TargetCHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Swissprot IdP36222
Protein Accession #NP_001267
Nucleotide Accession #NM_001276
Protein Size (# AA)383
Molecular Weight42kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CHI3L1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CHI3L1.
Protein InteractionsCHI3L1;
Write Your Own Review
You're reviewing:CHI3L1 Antibody - middle region (ARP51929_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Travel Grant
Free Microscope
Aviva Blast Tool