NMES1 Antibody - N-terminal region (ARP50069_P050)

• Product Number: ARP50069_P050
• Name: NMES1 Antibody - N-terminal region (ARP50069_P050)
• Protein Size (# AA): 83 amino acids
• Molecular Weight: 9 kDa
• NCBI Gene Id: 84419
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chromosome 15 open reading frame 48
• Description:
  View product citations for NMES1 Antibody - N-terminal region (ARP50069_P050) on CiteAb
• Alias Symbols: NMES1, FOAP-11, COXFA4L3, MIR147BHG
• Peptide Sequence: Synthetic peptide located within the following region: VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.
• Protein Interactions: TSSK3; ABL2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-C15orf48 (ARP50069_P050) antibody is Catalog # AAP50069
• Uniprot ID: Q9C002
• Protein Accession #: NP_115789
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032413
• Tested Species Reactivity: Human
• Gene Symbol: C15orf48
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
• Image 1: Human PANC1 Whole Cell
  
  Host: Rabbit
  Target Name: C15orf48
  Sample Tissue: Human PANC1 Whole Cell
  Antibody Dilution: 3ug/ml