Sku |
AAP50069 |
Price |
$99.00 |
Name |
C15orf48 Peptide - N-terminal region (AAP50069) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
C15orf48 |
Alias symbols |
FLJ22645, FOAP-11, MGC32925, NMES1 |
Gene id |
84419 |
Description of target |
This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified. |
Protein accession num |
NP_115789 |
Nucleotide accession num |
NM_032413 |
Protein size |
83 amino acids |
Molecular weight |
9kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-C15orf48 Antibody (ARP50069_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |