C15orf48 Peptide - N-terminal region (AAP50069)

Data Sheet
 
Sku AAP50069
Price $99.00
Name C15orf48 Peptide - N-terminal region (AAP50069)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene C15orf48
Alias symbols FLJ22645, FOAP-11, MGC32925, NMES1
Gene id 84419
Description of target This gene was identified by its low or completely missing expression in esophageal squamous cell carcinomas. Normal expression of the gene occurs in the esophagus, stomach, small intestine, colon and placenta. Alternatively spliced transcript variants that encode the same protein have been identified.
Protein accession num NP_115789
Nucleotide accession num NM_032413
Protein size 83 amino acids
Molecular weight 9kDa
Species reactivity Human
Application WB
Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-C15orf48 Antibody (ARP50069_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com