ADAM19 Antibody - N-terminal region (ARP49780_P050)

• Product Number: ARP49780_P050
• Name: ADAM19 Antibody - N-terminal region (ARP49780_P050)
• Protein Size (# AA): 956 amino acids
• Molecular Weight: 82kDa
• NCBI Gene Id: 8728
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ADAM metallopeptidase domain 19
• Description:
  View product citations for ADAM19 Antibody - N-terminal region (ARP49780_P050) on CiteAb
• Alias Symbols: MLTNB, FKSG34, MADDAM
• Peptide Sequence: Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Tanabe,C., (2007) Biochem. Biophys. Res. Commun. 352 (1), 111-117
• Description of Target: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
• Protein Interactions: UBC; TNFSF11; COPB1; NRG1; FURIN; A2M; ABI2; SH3GL2; ESF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ADAM19 (ARP49780_P050) antibody is Catalog # AAP49780 (Previous Catalog # AAPS27503)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM19
• Uniprot ID: Q9H013
• Protein Name: Disintegrin and metalloproteinase domain-containing protein 19
• Publications:

  Engineering attenuated virulence of a Theileria annulata-infected macrophage. PLoS Negl Trop Dis. 8, e3183 (2014). 25375322

  Marballi, K., Cruz, D., Thompson, P. & Walss-Bass, C. Differential neuregulin 1 cleavage in the prefrontal cortex and hippocampus in schizophrenia and bipolar disorder: preliminary findings. PLoS One 7, e36431 (2012). 22590542

• Protein Accession #: NP_075525
• Purification: Affinity Purified
• Nucleotide Accession #: NM_023038
• Tested Species Reactivity: Human
• Gene Symbol: ADAM19
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
• Image 1: Human Muscle
  
  WB Suggested Anti-ADAM19 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle
• Image 2: Human liver, MCF7
  
  Host: Rabbit
  Target: ADAM19
  Positive control (+): Human liver (LI)
  Negative control (-): MCF7 (N10)
  Antibody concentration: 1ug/ml