Size:100 ul
$319.00
In Stock
SKU
ARP49780_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49780_P050-FITC Conjugated

ARP49780_P050-HRP Conjugated

ARP49780_P050-Biotin Conjugated

ADAM19 Antibody - N-terminal region (ARP49780_P050)

Catalog#: ARP49780_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-25985 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM19
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Complete computational species homology data Anti-ADAM19 (ARP49780_P050)
Peptide Sequence Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ADAM19 (ARP49780_P050) antibody is Catalog # AAP49780 (Previous Catalog # AAPS27503)
Datasheets/Manuals Printable datasheet for anti-ADAM19 (ARP49780_P050) antibody
Target Reference Tanabe,C., (2007) Biochem. Biophys. Res. Commun. 352 (1), 111-117
Publications

Marballi, K., Cruz, D., Thompson, P. & Walss-Bass, C. Differential neuregulin 1 cleavage in the prefrontal cortex and hippocampus in schizophrenia and bipolar disorder: preliminary findings. PLoS One 7, e36431 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22590542

Gene Symbol ADAM19
Official Gene Full Name ADAM metallopeptidase domain 19
Alias Symbols FKSG34, MADDAM, MLTNB
NCBI Gene Id 8728
Protein Name Disintegrin and metalloproteinase domain-containing protein 19
Description of Target ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
Swissprot Id Q9H013
Protein Accession # NP_075525
Nucleotide Accession # NM_023038
Protein Size (# AA) 956
Molecular Weight 82kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADAM19.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADAM19.
Protein Interactions UBC; TNFSF11; COPB1; NRG1; FURIN; A2M; ABI2; SH3GL2; ESF1;
  1. What is the species homology for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ADAM19 Antibody - N-terminal region (ARP49780_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    This target may also be called "FKSG34, MADDAM, MLTNB" in publications.

  5. What is the shipping cost for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "82kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ADAM19 Antibody - N-terminal region (ARP49780_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ADAM19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ADAM19"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ADAM19"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ADAM19"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ADAM19"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ADAM19"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ADAM19 Antibody - N-terminal region (ARP49780_P050)
Your Rating
We found other products you might like!