ADAM19 Antibody - N-terminal region (ARP49780_P050)

Catalog No: ARP49780_P050

WB Suggested Anti-ADAM19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Host: Rabbit
Target: ADAM19
Positive control (+): Human liver (LI)
Negative control (-): MCF7 (N10)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM19
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ADAM19 (ARP49780_P050) antibody is Catalog # AAP49780 (Previous Catalog # AAPS27503)
• Reference: Tanabe,C., (2007) Biochem. Biophys. Res. Commun. 352 (1), 111-117
• Publications:

  Engineering attenuated virulence of a Theileria annulata-infected macrophage. PLoS Negl Trop Dis. 8, e3183 (2014). 25375322

  Marballi, K., Cruz, D., Thompson, P. & Walss-Bass, C. Differential neuregulin 1 cleavage in the prefrontal cortex and hippocampus in schizophrenia and bipolar disorder: preliminary findings. PLoS One 7, e36431 (2012). 22590542

Target Info

• Gene Symbol: ADAM19
• Gene Full Name: ADAM metallopeptidase domain 19
• Alias Symbols: MLTNB, FKSG34, MADDAM
• NCBI Gene Id: 8728
• Protein Name: Disintegrin and metalloproteinase domain-containing protein 19
• Description of Target: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
• Uniprot ID: Q9H013
• Protein Accession #: NP_075525
• Nucleotide Accession #: NM_023038
• Protein Size (# AA): 956
• Molecular Weight: 82kDa
• Protein Interactions: UBC; TNFSF11; COPB1; NRG1; FURIN; A2M; ABI2; SH3GL2; ESF1;