Search Antibody, Protein, and ELISA Kit Solutions

ADAM19 antibody - N-terminal region (ARP49780_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49780_P050-FITC Conjugated

ARP49780_P050-HRP Conjugated

ARP49780_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
ADAM metallopeptidase domain 19
Protein Name:
Disintegrin and metalloproteinase domain-containing protein 19
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-25985 from Santa Cruz Biotechnology.
Description of Target:
ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADAM19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADAM19.
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAM19
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Complete computational species homology data:
Anti-ADAM19 (ARP49780_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADAM19 (ARP49780_P050) antibody is Catalog # AAP49780 (Previous Catalog # AAPS27503)
Printable datasheet for anti-ADAM19 (ARP49780_P050) antibody
Target Reference:
Tanabe,C., (2007) Biochem. Biophys. Res. Commun. 352 (1), 111-117

Marballi, K., Cruz, D., Thompson, P. & Walss-Bass, C. Differential neuregulin 1 cleavage in the prefrontal cortex and hippocampus in schizophrenia and bipolar disorder: preliminary findings. PLoS One 7, e36431 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22590542

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...