XYLT2 Antibody - C-terminal region : HRP (ARP49703_P050-HRP)

Data Sheet
 
Product Number ARP49703_P050-HRP
Product Page www.avivasysbio.com/xylt2-antibody-c-terminal-region-hrp-arp49703-p050-hrp.html
Name XYLT2 Antibody - C-terminal region : HRP (ARP49703_P050-HRP)
Protein Size (# AA) 865 amino acids
Molecular Weight 97kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 64132
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Xylosyltransferase II
Alias Symbols SOS, XT2, XT-II, PXYLT2, xylT-II
Peptide Sequence Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Casanova,J.C., (2008) Biochem. Biophys. Res. Commun. 365 (4), 678-684
Description of Target XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.The protein encoded by this gene is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-XYLT2 (ARP49703_P050-HRP) antibody
Blocking Peptide For anti-XYLT2 (ARP49703_P050-HRP) antibody is Catalog # AAP49703 (Previous Catalog # AAPP29284)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human XYLT2
Uniprot ID Q9H1B5
Protein Name Xylosyltransferase 2
Protein Accession # NP_071450
Purification Affinity Purified
Nucleotide Accession # NM_022167
Gene Symbol XYLT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com