| Product Number |
ARP49569_P050 |
| Product Page |
www.avivasysbio.com/aadacl1-antibody-middle-region-arp49569-p050.html |
| Name |
Aadacl1 Antibody - middle region (ARP49569_P050) |
| Protein Size (# AA) |
408 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
320024 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Arylacetamide deacetylase-like 1 |
| Alias Symbols |
Aad, CPO, Nceh, CPO-BP, Aadacl1, B230106I24Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Aadacl1 is hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. It may be responsible for cholesterol ester hydrolysis in macrophages. It also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-Nceh1 (ARP49569_P050) antibody |
| Blocking Peptide |
For anti-Nceh1 (ARP49569_P050) antibody is Catalog # AAP49569 (Previous Catalog # AAPP43746) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BLF1 |
| Protein Name |
Neutral cholesterol ester hydrolase 1 |
| Protein Accession # |
NP_848887 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178772 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Nceh1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.
|
|
