UGT1A7 Antibody - N-terminal region (ARP49438_P050)

• Product Number: ARP49438_P050
• Name: UGT1A7 Antibody - N-terminal region (ARP49438_P050)
• Protein Size (# AA): 530 amino acids
• Molecular Weight: 57kDa
• NCBI Gene Id: 54577
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: UDP glucuronosyltransferase 1 family, polypeptide A7
• Alias Symbols: GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, UGT1.1, UGT1.7, UGT1A1, UGT1-01, UGT1-07, hUG-BR1, UDPGT 1-7
• Peptide Sequence: Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lankisch,T.O., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (3), 695-701
• Description of Target: UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-UGT1A7 (ARP49438_P050) antibody is Catalog # AAP49438 (Previous Catalog # AAPP29157)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
• Uniprot ID: Q5DSZ7
• Protein Name: UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B

• Protein Accession #: NP_061950
• Purification: Affinity Purified
• Nucleotide Accession #: NM_019077
• Tested Species Reactivity: Human
• Gene Symbol: UGT1A7
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Adult Liver
  
  Rabbit Anti-UGT1A7 Antibody
  Catalog Number: ARP49438_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 2: Human 721_B
  
  WB Suggested Anti-UGT1A7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:2500
  Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B
• Image 3: Human OVCAR-3 Whole Cell
  
  Host: Rabbit
  Target Name: UGT1A7
  Sample Tissue: Human OVCAR-3 Whole Cell
  Antibody Dilution: 1ug/ml