Search Antibody, Protein, and ELISA Kit Solutions

UGT1A7 Antibody - N-terminal region (ARP49438_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49438_P050-FITC Conjugated

ARP49438_P050-HRP Conjugated

ARP49438_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-UGT1A7 (ARP49438_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-UGT1A7 (ARP49438_P050) antibody is Catalog # AAP49438 (Previous Catalog # AAPP29157)
Printable datasheet for anti-UGT1A7 (ARP49438_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B

Target Reference:
Lankisch,T.O., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (3), 695-701
Gene Symbol:
Official Gene Full Name:
UDP glucuronosyltransferase 1 family, polypeptide A7
Alias Symbols:
UDPGT, UGT1G, UGT-1G, UGT1.7, UGT1-07, UDPGT 1-7
NCBI Gene Id:
Protein Name:
UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1
Description of Target:
UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UGT1A7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UGT1A7.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...