Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UGT1A7 antibody - N-terminal region (ARP49438_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP49438_P050-FITC Conjugated

ARP49438_P050-HRP Conjugated

ARP49438_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
UGT1A7
NCBI Gene Id:
54577
Official Gene Full Name:
UDP glucuronosyltransferase 1 family, polypeptide A7
Protein Name:
UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1
Swissprot Id:
Q5DSZ7
Protein Accession #:
NP_061950
Nucleotide Accession #:
NM_019077
Alias Symbols:
UDPGT, UGT1G, UGT-1G, UGT1.7, UGT1-07, UDPGT 1-7
Description of Target:
UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
530
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UGT1A7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UGT1A7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-UGT1A7 (ARP49438_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-UGT1A7 (ARP49438_P050) antibody is Catalog # AAP49438 (Previous Catalog # AAPP29157)
Datasheets/Manuals:
Printable datasheet for anti-UGT1A7 (ARP49438_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B

Target Reference:
Lankisch,T.O., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (3), 695-701

Tell us what you think about this item!

Write A Review
    Please, wait...