Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP49438_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49438_P050-FITC Conjugated

ARP49438_P050-HRP Conjugated

ARP49438_P050-Biotin Conjugated

UGT1A7 Antibody - N-terminal region (ARP49438_P050)

Catalog#: ARP49438_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-UGT1A7 (ARP49438_P050)
Peptide Sequence Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-UGT1A7 (ARP49438_P050) antibody is Catalog # AAP49438 (Previous Catalog # AAPP29157)
Datasheets/Manuals Printable datasheet for anti-UGT1A7 (ARP49438_P050) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B

Target Reference Lankisch,T.O., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (3), 695-701
Gene Symbol UGT1A7
Official Gene Full Name UDP glucuronosyltransferase 1 family, polypeptide A7
Alias Symbols UDPGT, UGT1G, UGT-1G, UGT1.7, UGT1-07, UDPGT 1-7
NCBI Gene Id 54577
Protein Name UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1
Description of Target UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q5DSZ7
Protein Accession # NP_061950
Nucleotide Accession # NM_019077
Protein Size (# AA) 530
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express UGT1A7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express UGT1A7.
  1. What is the species homology for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UGT1A7 Antibody - N-terminal region (ARP49438_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    This target may also be called "UDPGT, UGT1G, UGT-1G, UGT1.7, UGT1-07, UDPGT 1-7" in publications.

  5. What is the shipping cost for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UGT1A7 Antibody - N-terminal region (ARP49438_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "UGT1A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UGT1A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UGT1A7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UGT1A7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UGT1A7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UGT1A7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UGT1A7 Antibody - N-terminal region (ARP49438_P050)
Your Rating