GGPS1 Antibody - middle region (ARP48534_P050)

• Product Number: ARP48534_P050
• Name: GGPS1 Antibody - middle region (ARP48534_P050)
• Protein Size (# AA): 300 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 9453
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Geranylgeranyl diphosphate synthase 1
• Alias Symbols: GGPPS, GGPPS1
• Peptide Sequence: Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Raz,T., (2007) Blood 110 (6), 2102-2109
• Description of Target: GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Protein Interactions: GGPS1; ATOX1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GGPS1 (ARP48534_P050) antibody is Catalog # AAP48534 (Previous Catalog # AAPY01478)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GGPS1
• Uniprot ID: O95749
• Protein Name: Geranylgeranyl pyrophosphate synthase
• Sample Type Confirmation:

  GGPS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_001032354
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001037277
• Tested Species Reactivity: Human
• Gene Symbol: GGPS1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human Pineal Tissue
  
  Rabbit Anti-GGPS1 Antibody
  Catalog Number: ARP48534_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in endothelial cells in blood vessels
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2: Human HEK293T
  
  WB Suggested Anti-GGPS1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 293T cell lysateGGPS1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells