Search Antibody, Protein, and ELISA Kit Solutions

GGPS1 Antibody - middle region (ARP48534_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48534_P050-FITC Conjugated

ARP48534_P050-HRP Conjugated

ARP48534_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Geranylgeranyl diphosphate synthase 1
NCBI Gene Id:
Protein Name:
Geranylgeranyl pyrophosphate synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-145390 from Santa Cruz Biotechnology.
Description of Target:
GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GGPS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GGPS1.
The immunogen is a synthetic peptide directed towards the middle region of human GGPS1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GGPS1 (ARP48534_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GGPS1 (ARP48534_P050) antibody is Catalog # AAP48534 (Previous Catalog # AAPY01478)
Printable datasheet for anti-GGPS1 (ARP48534_P050) antibody
Sample Type Confirmation:

GGPS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Raz,T., (2007) Blood 110 (6), 2102-2109

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...