Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP48534_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48534_P050-FITC Conjugated

ARP48534_P050-HRP Conjugated

ARP48534_P050-Biotin Conjugated

GGPS1 Antibody - middle region (ARP48534_P050)

Catalog#: ARP48534_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145390 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GGPS1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-GGPS1 (ARP48534_P050)
Peptide Sequence Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GGPS1 (ARP48534_P050) antibody is Catalog # AAP48534 (Previous Catalog # AAPY01478)
Datasheets/Manuals Printable datasheet for anti-GGPS1 (ARP48534_P050) antibody
Sample Type Confirmation

GGPS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Raz,T., (2007) Blood 110 (6), 2102-2109
Gene Symbol GGPS1
Official Gene Full Name Geranylgeranyl diphosphate synthase 1
Alias Symbols GGPPS, GGPPS1
NCBI Gene Id 9453
Protein Name Geranylgeranyl pyrophosphate synthase
Description of Target GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Swissprot Id O95749
Protein Accession # NP_001032354
Nucleotide Accession # NM_001037277
Protein Size (# AA) 300
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GGPS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GGPS1.
Protein Interactions GGPS1; ATOX1; UBC;
  1. What is the species homology for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "GGPS1 Antibody - middle region (ARP48534_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GGPS1 Antibody - middle region (ARP48534_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    This target may also be called "GGPPS, GGPPS1" in publications.

  5. What is the shipping cost for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GGPS1 Antibody - middle region (ARP48534_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "GGPS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GGPS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GGPS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GGPS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GGPS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GGPS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GGPS1 Antibody - middle region (ARP48534_P050)
Your Rating
We found other products you might like!