Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GGPS1 antibody - middle region (ARP48534_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP48534_P050-FITC Conjugated

ARP48534_P050-HRP Conjugated

ARP48534_P050-Biotin Conjugated

Gene Symbol:
GGPS1
NCBI Gene Id:
9453
Official Gene Full Name:
Geranylgeranyl diphosphate synthase 1
Protein Name:
Geranylgeranyl pyrophosphate synthase
Swissprot Id:
O95749
Protein Accession #:
NP_001032354
Nucleotide Accession #:
NM_001037277
Alias Symbols:
GGPPS, GGPPS1
Replacement Item:
This antibody may replace item sc-145390 from Santa Cruz Biotechnology.
Description of Target:
GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Size (# AA):
300
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GGPS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GGPS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GGPS1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-GGPS1 (ARP48534_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GGPS1; ATOX1; UBC;
Blocking Peptide:
For anti-GGPS1 (ARP48534_P050) antibody is Catalog # AAP48534 (Previous Catalog # AAPY01478)
Datasheets/Manuals:
Printable datasheet for anti-GGPS1 (ARP48534_P050) antibody
Sample Type Confirmation:

GGPS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Raz,T., (2007) Blood 110 (6), 2102-2109

Tell us what you think about this item!

Write A Review
    Please, wait...