| Product Number |
ARP48390_T100 |
| Product Page |
www.avivasysbio.com/lztfl1-antibody-c-terminal-region-arp48390-t100.html |
| Name |
LZTFL1 Antibody - C-terminal region (ARP48390_T100) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
54585 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Leucine zipper transcription factor-like 1 |
| Alias Symbols |
BBS17 |
| Peptide Sequence |
Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kiss,H., (2001) Genomics 73 (1), 10-19 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
WDYHV1; LZTFL1; SDCBP; UBC; SH3GLB2; RPUSD2; UBXN7; PES1; BLMH; FZD5; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LZTFL1 (ARP48390_T100) antibody |
| Blocking Peptide |
For anti-LZTFL1 (ARP48390_T100) antibody is Catalog # AAP48390 (Previous Catalog # AAPY01772) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LZTFL1 |
| Uniprot ID |
Q9NQ48 |
| Protein Name |
Leucine zipper transcription factor-like protein 1 |
| Publications |
Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). 22093827 |
| Sample Type Confirmation |
LZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_065080 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020347 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LZTFL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-LZTFL1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysateLZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
