LZTFL1 Antibody - C-terminal region (ARP48390_T100)

Catalog#: ARP48390_T100

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: LZTFL1
• Official Gene Full Name: Leucine zipper transcription factor-like 1
• NCBI Gene Id: 54585
• Protein Name: Leucine zipper transcription factor-like protein 1
• Swissprot Id: Q9NQ48
• Protein Accession #: NP_065080
• Nucleotide Accession #: NM_020347
• Alias Symbols: FLJ36386
• Replacement Item: This antibody may replace item sc-100968 from Santa Cruz Biotechnology.
• Description of Target: The function remains unknown.
• Protein Size (# AA): 299
• Molecular Weight: 34kDa
• Purification: Protein A purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express LZTFL1.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LZTFL1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: WDYHV1; LZTFL1; SDCBP; UBC; SH3GLB2; RPUSD2; UBXN7; PES1; BLMH; FZD5; ELAVL1;
• Blocking Peptide: For anti-LZTFL1 (ARP48390_T100) antibody is Catalog # AAP48390 (Previous Catalog # AAPY01772)
• Sample Type Confirmation:

  LZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Target Reference: Kiss,H., (2001) Genomics 73 (1), 10-19
• Publications:

  Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22093827

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: LZTFL1 antibody tested with Human Jurkat Cells (ARP48390_T100)