Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

LZTFL1 Antibody - C-terminal region (ARP48390_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48390_T100-FITC Conjugated

ARP48390_T100-HRP Conjugated

ARP48390_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Leucine zipper transcription factor-like 1
NCBI Gene Id:
Protein Name:
Leucine zipper transcription factor-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100968 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LZTFL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LZTFL1.
The immunogen is a synthetic peptide directed towards the C terminal region of human LZTFL1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-LZTFL1 (ARP48390_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LZTFL1 (ARP48390_T100) antibody is Catalog # AAP48390 (Previous Catalog # AAPY01772)
Printable datasheet for anti-LZTFL1 (ARP48390_T100) antibody
Sample Type Confirmation:

LZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kiss,H., (2001) Genomics 73 (1), 10-19

Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22093827

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...