Size:100 ul
$229.00
In stock
SKU
ARP48390_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48390_T100-FITC Conjugated

ARP48390_T100-HRP Conjugated

ARP48390_T100-Biotin Conjugated

LZTFL1 Antibody - C-terminal region (ARP48390_T100)

Catalog#: ARP48390_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100968 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LZTFL1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-LZTFL1 (ARP48390_T100)
Peptide Sequence Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LZTFL1 (ARP48390_T100) antibody is Catalog # AAP48390 (Previous Catalog # AAPY01772)
Datasheets/Manuals Printable datasheet for anti-LZTFL1 (ARP48390_T100) antibody
Sample Type Confirmation

LZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Kiss,H., (2001) Genomics 73 (1), 10-19
Publications

Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22093827

Gene Symbol LZTFL1
Official Gene Full Name Leucine zipper transcription factor-like 1
Alias Symbols FLJ36386
NCBI Gene Id 54585
Protein Name Leucine zipper transcription factor-like protein 1
Description of Target The function remains unknown.
Swissprot Id Q9NQ48
Protein Accession # NP_065080
Nucleotide Accession # NM_020347
Protein Size (# AA) 299
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LZTFL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LZTFL1.
Protein Interactions WDYHV1; LZTFL1; SDCBP; UBC; SH3GLB2; RPUSD2; UBXN7; PES1; BLMH; FZD5; ELAVL1;
Write Your Own Review
You're reviewing:LZTFL1 Antibody - C-terminal region (ARP48390_T100)
Your Rating