- Gene Symbol:
- LZTFL1
- NCBI Gene Id:
- 54585
- Official Gene Full Name:
- Leucine zipper transcription factor-like 1
- Protein Name:
- Leucine zipper transcription factor-like protein 1
- Swissprot Id:
- Q9NQ48
- Protein Accession #:
- NP_065080
- Nucleotide Accession #:
- NM_020347
- Alias Symbols:
- FLJ36386
- Replacement Item:
- This antibody may replace item sc-100968 from Santa Cruz Biotechnology.
- Description of Target:
- The function remains unknown.
- Protein Size (# AA):
- 299
- Molecular Weight:
- 34kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express LZTFL1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express LZTFL1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the C terminal region of human LZTFL1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
- Complete computational species homology data:
- Anti-LZTFL1 (ARP48390_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- WDYHV1; LZTFL1; SDCBP; UBC; SH3GLB2; RPUSD2; UBXN7; PES1; BLMH; FZD5; ELAVL1;
- Blocking Peptide:
- For anti-LZTFL1 (ARP48390_T100) antibody is Catalog # AAP48390 (Previous Catalog # AAPY01772)
- Datasheets/Manuals:
- Printable datasheet for anti-LZTFL1 (ARP48390_T100) antibody
- Sample Type Confirmation:
LZTFL1 is supported by BioGPS gene expression data to be expressed in Jurkat
- Target Reference:
- Kiss,H., (2001) Genomics 73 (1), 10-19
- Publications:
Sakurai, T. et al. Involvement of leucine zipper transcription factor-like protein 1 (Lztfl1) in the attenuation of cognitive impairment by exercise training. Biochem. Biophys. Res. Commun. 416, 125-9 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22093827
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
