GOT1 Antibody - N-terminal region (ARP48205_P050)

• Product Number: ARP48205_P050
• Name: GOT1 Antibody - N-terminal region (ARP48205_P050)
• Protein Size (# AA): 413 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 2805
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
• Alias Symbols: AST1, cCAT, GIG18, cAspAT, ASTQTL1
• Peptide Sequence: Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008)
• Description of Target: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enz
• Protein Interactions: UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GOT1 (ARP48205_P050) antibody is Catalog # AAP48205 (Previous Catalog # AAPP13024)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
• Uniprot ID: P17174
• Protein Name: Aspartate aminotransferase, cytoplasmic
• Publications:

  Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). 23704975

  Takeda, K., Ishida, A., Takahashi, K. & Ueda, T. Synaptic vesicles are capable of synthesizing the VGLUT substrate glutamate from a-ketoglutarate for vesicular loading. J. Neurochem. 121, 184-96 (2012). 22309504

• Sample Type Confirmation:

  GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226

• Protein Accession #: NP_002070
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002079
• Tested Species Reactivity: Human
• Gene Symbol: GOT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85%
• Image 1: Human Fetal Liver
  
  Host: Rabbit
  Target Name: GOT1
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 2: Human NCI-H226
  
  Host: Rabbit
  Target Name: GOT1
  Sample Type: NCI-H226
  Antibody Dilution: 1.0ug/mlGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226
• Image 3: Human NCI-H226
  
  WB Suggested Anti-GOT1 Antibody
  Titration: 1 ug/ml
  Positive Control: NCI-H226 Whole CellGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226
• Image 4: Human Pineal Tissue
  
  Rabbit Anti-GOT1 Antibody
  Catalog Number: ARP48205_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec