Product Number |
ARP48205_P050 |
Product Page |
www.avivasysbio.com/got1-antibody-n-terminal-region-arp48205-p050.html |
Name |
GOT1 Antibody - N-terminal region (ARP48205_P050) |
Protein Size (# AA) |
413 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
2805 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) |
Alias Symbols |
AST1, cCAT, GIG18, cAspAT, ASTQTL1 |
Peptide Sequence |
Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008) |
Description of Target |
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enz |
Protein Interactions |
UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GOT1 (ARP48205_P050) antibody |
Blocking Peptide |
For anti-GOT1 (ARP48205_P050) antibody is Catalog # AAP48205 (Previous Catalog # AAPP13024) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1 |
Uniprot ID |
P17174 |
Protein Name |
Aspartate aminotransferase, cytoplasmic |
Publications |
Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). 23704975
Takeda, K., Ishida, A., Takahashi, K. & Ueda, T. Synaptic vesicles are capable of synthesizing the VGLUT substrate glutamate from a-ketoglutarate for vesicular loading. J. Neurochem. 121, 184-96 (2012). 22309504 |
Sample Type Confirmation |
GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
Protein Accession # |
NP_002070 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002079 |
Tested Species Reactivity |
Human |
Gene Symbol |
GOT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85% |
Image 1 | Human Fetal Liver
| Host: Rabbit Target Name: GOT1 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human NCI-H226
| Host: Rabbit Target Name: GOT1 Sample Type: NCI-H226 Antibody Dilution: 1.0ug/mlGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
Image 3 | Human NCI-H226
| WB Suggested Anti-GOT1 Antibody Titration: 1 ug/ml Positive Control: NCI-H226 Whole CellGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
Image 4 | Human Pineal Tissue
| Rabbit Anti-GOT1 Antibody Catalog Number: ARP48205_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|