Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP48205_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48205_P050-FITC Conjugated

ARP48205_P050-HRP Conjugated

ARP48205_P050-Biotin Conjugated

GOT1 Antibody - N-terminal region (ARP48205_P050)

Catalog#: ARP48205_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-367196 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85%
Complete computational species homology data Anti-GOT1 (ARP48205_P050)
Peptide Sequence Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-GOT1 (ARP48205_P050) antibody is Catalog # AAP48205 (Previous Catalog # AAPP13024)
Datasheets/Manuals Printable datasheet for anti-GOT1 (ARP48205_P050) antibody
Sample Type Confirmation

GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Target Reference Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008)
Publications

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). IHC, WB, Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23704975

Takeda, K., Ishida, A., Takahashi, K. & Ueda, T. Synaptic vesicles are capable of synthesizing the VGLUT substrate glutamate from -alpha-ketoglutarate for vesicular loading. J. Neurochem. 121, 184-96 (2012). IHC, WB, Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22309504

Gene Symbol GOT1
Official Gene Full Name Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
Alias Symbols GIG18, ASTQTL1
NCBI Gene Id 2805
Protein Name Aspartate aminotransferase, cytoplasmic
Description of Target Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enz
Swissprot Id P17174
Protein Accession # NP_002070
Nucleotide Accession # NM_002079
Protein Size (# AA) 413
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GOT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GOT1.
Protein Interactions UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC;
Write Your Own Review
You're reviewing:GOT1 Antibody - N-terminal region (ARP48205_P050)
Your Rating