Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GOT1 antibody - N-terminal region (ARP48205_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP48205_P050-FITC Conjugated

ARP48205_P050-HRP Conjugated

ARP48205_P050-Biotin Conjugated

Gene Symbol:
GOT1
NCBI Gene Id:
2805
Official Gene Full Name:
Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)
Protein Name:
Aspartate aminotransferase, cytoplasmic
Swissprot Id:
P17174
Protein Accession #:
NP_002070
Nucleotide Accession #:
NM_002079
Alias Symbols:
GIG18, ASTQTL1
Replacement Item:
This antibody may replace item sc-367196 from Santa Cruz Biotechnology.
Description of Target:
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enz
Protein Size (# AA):
413
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GOT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GOT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
Species Reactivity:
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85%
Complete computational species homology data:
Anti-GOT1 (ARP48205_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC;
Blocking Peptide:
For anti-GOT1 (ARP48205_P050) antibody is Catalog # AAP48205 (Previous Catalog # AAPP13024)
Datasheets/Manuals:
Printable datasheet for anti-GOT1 (ARP48205_P050) antibody
Sample Type Confirmation:

GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Target Reference:
Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008)
Publications:

Takeda, K., Ishida, A., Takahashi, K. & Ueda, T. Synaptic vesicles are capable of synthesizing the VGLUT substrate glutamate from -alpha-ketoglutarate for vesicular loading. J. Neurochem. 121, 184-96 (2012). IHC, WB, Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22309504

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). IHC, WB, Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23704975

Tell us what you think about this item!

Write A Review
    Please, wait...