CTH Antibody - N-terminal region (ARP46067_P050)

• Product Number: ARP46067_P050
• Name: CTH Antibody - N-terminal region (ARP46067_P050)
• Protein Size (# AA): 405 amino acids
• Molecular Weight: 45 kDa
• NCBI Gene Id: 1491
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cystathionase (cystathionine gamma-lyase)
• Alias Symbols: MGC9471
• Peptide Sequence: Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Moore,L.E., (2007) Int. J. Cancer 120 (11), 2452-2458
• Description of Target: CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
• Protein Interactions: GUCD1; WDYHV1; RECK; CTH; PTMA; GMDS; CAPN2; ATIC; SDCBP2; UBC; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CTH (ARP46067_P050) antibody is Catalog # AAP46067 (Previous Catalog # AAPS17301)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTH
• Uniprot ID: P32929
• Protein Name: Cystathionine gamma-lyase
• Publications:

  An emerging role for gasotransmitters in the control of breathing and ionic regulation in fish. J. Comp. Physiol. B, Biochem. Syst. Environ. Physiol. 186, 145-59 (2016). 26660653

  Kumai, Y., Porteus, C. S., Kwong, R. W. M. & Perry, S. F. Hydrogen sulfide inhibits Na(+) uptake in larval zebrafish, Danio rerio. Pflugers Arch. doi:10.1007/s00424-014-1550-y (2014). 24939700

  Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). 24756639

• Protein Accession #: NP_001893
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001902
• Tested Species Reactivity: Human
• Gene Symbol: CTH
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: CTH
  Sample Tissue: Human HepG2 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 2: Human HCT116 Whole Cell
  
  Host: Rabbit
  Target Name: CTH
  Sample Tissue: Human HCT116 Whole Cell
  Antibody Dilution: 1ug/ml