Size:100 ul
$319.00
In Stock
SKU
ARP46067_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46067_P050-FITC Conjugated

ARP46067_P050-HRP Conjugated

ARP46067_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101924 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CTH
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-CTH (ARP46067_P050)
Peptide Sequence Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CTH (ARP46067_P050) antibody is Catalog # AAP46067 (Previous Catalog # AAPS17301)
Datasheets/Manuals Printable datasheet for anti-CTH (ARP46067_P050) antibody
Target Reference Moore,L.E., (2007) Int. J. Cancer 120 (11), 2452-2458
Publications

Kumai, Y., Porteus, C. S., Kwong, R. W. M. & Perry, S. F. Hydrogen sulfide inhibits Na(+) uptake in larval zebrafish, Danio rerio. Pflugers Arch. 467, 651-64 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24939700

Perry, S; Kumai, Y; Porteus, CS; Tzaneva, V; Kwong, RW; An emerging role for gasotransmitters in the control of breathing and ionic regulation in fish. 186, 145-59 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26660653

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24756639

Gene Symbol CTH
Official Gene Full Name Cystathionase (cystathionine gamma-lyase)
Alias Symbols MGC9471
NCBI Gene Id 1491
Protein Name Cystathionine gamma-lyase
Description of Target CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Swissprot Id P32929
Protein Accession # NP_001893
Nucleotide Accession # NM_001902
Protein Size (# AA) 405
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CTH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CTH.
Protein Interactions GUCD1; WDYHV1; RECK; CTH; PTMA; GMDS; CAPN2; ATIC; SDCBP2; UBC; ELAVL1;
  1. What is the species homology for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "CTH Antibody - N-terminal region (ARP46067_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTH Antibody - N-terminal region (ARP46067_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    This target may also be called "MGC9471" in publications.

  5. What is the shipping cost for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTH Antibody - N-terminal region (ARP46067_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CTH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTH Antibody - N-terminal region (ARP46067_P050)
Your Rating
We found other products you might like!