Search Antibody, Protein, and ELISA Kit Solutions

CTH antibody - N-terminal region (ARP46067_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46067_P050-FITC Conjugated

ARP46067_P050-HRP Conjugated

ARP46067_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cystathionase (cystathionine gamma-lyase)
Protein Name:
Cystathionine gamma-lyase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101924 from Santa Cruz Biotechnology.
Description of Target:
CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CTH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CTH.
The immunogen is a synthetic peptide directed towards the N terminal region of human CTH
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CTH (ARP46067_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CTH (ARP46067_P050) antibody is Catalog # AAP46067 (Previous Catalog # AAPS17301)
Printable datasheet for anti-CTH (ARP46067_P050) antibody
Target Reference:
Moore,L.E., (2007) Int. J. Cancer 120 (11), 2452-2458

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24756639

Kumai, Y., Porteus, C. S., Kwong, R. W. M. & Perry, S. F. Hydrogen sulfide inhibits Na(+) uptake in larval zebrafish, Danio rerio. Pflugers Arch. (2014). doi:10.1007/s00424-014-1550-y WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24939700

Perry, S; Kumai, Y; Porteus, CS; Tzaneva, V; Kwong, RW; An emerging role for gasotransmitters in the control of breathing and ionic regulation in fish. 186, 145-59 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26660653

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...