C21orf13 Antibody - N-terminal region : Biotin (ARP45912_P050-Biotin)

• Product Number: ARP45912_P050-Biotin
• Name: C21orf13 Antibody - N-terminal region : Biotin (ARP45912_P050-Biotin)
• Protein Size (# AA): 670 amino acids
• Molecular Weight: 76kDa
• Conjugation: Biotin
• NCBI Gene Id: 150082
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Leber congenital amaurosis 5-like
• Alias Symbols: C21orf13
• Peptide Sequence: Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: den (2007) Nat. Genet. 39 (7), 889-895
• Description of Target: The function of the C21orf13 protein remains unknown.
• Protein Interactions: TFIP11; NMI; TPM3; SUV39H2;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-LCA5L (ARP45912_P050-Biotin) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
• Uniprot ID: O95447
• Protein Name: Lebercilin-like protein
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828

• Protein Accession #: NP_689718
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152505
• Gene Symbol: LCA5L
• Predicted Species Reactivity: Human, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Yeast: 75%
• Image 1: