Search Antibody, Protein, and ELISA Kit Solutions

C21orf13 Antibody - N-terminal region : Biotin (ARP45912_P050-Biotin)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45912_P050 Unconjugated

ARP45912_P050-FITC Conjugated

ARP45912_P050-HRP Conjugated

Predicted Species Reactivity:
Human, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Yeast: 75%
Complete computational species homology data:
Anti-C21orf13 (ARP45912_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-LCA5L (ARP45912_P050-Biotin) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
Datasheets/Manuals:
Printable datasheet for anti-LCA5L (ARP45912_P050-Biotin) antibody
Target Reference:
den (2007) Nat. Genet. 39 (7), 889-895
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828

Gene Symbol:
LCA5L
Official Gene Full Name:
Leber congenital amaurosis 5-like
Alias Symbols:
MGC33295, C21orf13
NCBI Gene Id:
150082
Protein Name:
Lebercilin-like protein
Description of Target:
The function of the C21orf13 protein remains unknown.
Swissprot Id:
O95447
Protein Accession #:
NP_689718
Nucleotide Accession #:
NM_152505
Protein Size (# AA):
670
Molecular Weight:
76kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C21orf13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
Protein Interactions:
TFIP11; NMI; TPM3; SUV39H2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...