UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)

• Product Number: ARP45510_P050-HRP
• Name: UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)
• Protein Size (# AA): 931 amino acids
• Molecular Weight: 103kDa
• Conjugation: HRP: Horseradish Peroxidase
• NCBI Gene Id: 8633
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Unc-5 homolog C (C. elegans)
• Alias Symbols: UNC5H3
• Peptide Sequence: Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Reference: Shin,S.K., (2007) Gastroenterology 133 (6), 1849-1857
• Description of Target: UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
• Protein Interactions: DAP; NPM1; NTN1; DAPK1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-UNC5C (ARP45510_P050-HRP) antibody is Catalog # AAP45510 (Previous Catalog # AAPP26572)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UNC5C
• Uniprot ID: O95185
• Protein Name: Netrin receptor UNC5C
• Protein Accession #: NP_003719
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003728
• Gene Symbol: UNC5C
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: