Size:100 ul
$289.00
In Stock
SKU
ARP45510_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45510_P050 Unconjugated

ARP45510_P050-FITC Conjugated

ARP45510_P050-Biotin Conjugated

UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)

Catalog#: ARP45510_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UNC5C
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-UNC5C (ARP45510_P050)
Peptide Sequence Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
Concentration 0.5 mg/ml
Blocking Peptide For anti-UNC5C (ARP45510_P050-HRP) antibody is Catalog # AAP45510 (Previous Catalog # AAPP26572)
Datasheets/Manuals Printable datasheet for anti-UNC5C (ARP45510_P050-HRP) antibody
Target Reference Shin,S.K., (2007) Gastroenterology 133 (6), 1849-1857
Gene Symbol UNC5C
Official Gene Full Name Unc-5 homolog C (C. elegans)
Alias Symbols UNC5H3
NCBI Gene Id 8633
Protein Name Netrin receptor UNC5C
Description of Target UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Swissprot Id O95185
Protein Accession # NP_003719
Nucleotide Accession # NM_003728
Protein Size (# AA) 931
Molecular Weight 103kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express UNC5C.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express UNC5C.
Protein Interactions DAP; NPM1; NTN1; DAPK1;
  1. What is the species homology for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    This target may also be called "UNC5H3" in publications.

  5. What is the shipping cost for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "103kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "UNC5C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UNC5C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UNC5C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UNC5C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UNC5C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UNC5C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UNC5C Antibody - C-terminal region : HRP (ARP45510_P050-HRP)
Your Rating
We found other products you might like!