HMOX1 Antibody - N-terminal region (ARP45222_P050)

• Product Number: ARP45222_P050
• Name: HMOX1 Antibody - N-terminal region (ARP45222_P050)
• Protein Size (# AA): 288 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 3162
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Heme oxygenase (decycling) 1
• Description:
  View product citations for HMOX1 Antibody - N-terminal region (ARP45222_P050) on CiteAb
• Alias Symbols: HO-1, HSP32, HMOX1D, bK286B10
• Peptide Sequence: Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2.
• Protein Interactions: CCDC155; UBC; TUT1; CPSF1; ASL; POT1; TERF1; ELAVL1; HMX1; BLVRB; AKT1; NOS1; HMOX1; POR; UFD1L; PSMD2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HMOX1 (ARP45222_P050) antibody is Catalog # AAP45222
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
• Uniprot ID: P09601
• Protein Name: Heme oxygenase 1
• Publications:

  Kawahara, G. et al. Dystrophic muscle improvement in zebrafish via increased heme oxygenase signaling. Hum. Mol. Genet. 23, 1869-78 (2014). 24234649

• Protein Accession #: NP_002124
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002133
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: HMOX1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse Spleen
  
  Host: Mouse
  Target Name: HMOX1
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 2: Mouse Spleen
  
  Host: Rabbit
  Target Name: HMOX1
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 3: Human Jurkat
  
  Host: Rabbit
  Target Name: HMOX1
  Sample Type: Jurkat Whole Cell lysates
  Antibody Dilution: 1.0ug/ml
• Image 4: Human, Rat
  
  HMOX1 antibody - N-terminal region (ARP45222_P050) validated by WB using tonsil and fibroblast at 1:1000.
• Image 5: Human Ovary
  
  Rabbit Anti-HMOX1 Antibody
  Catalog Number: ARP45222_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue
  Observed Staining: Cytoplasm
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec